[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yomN
DDBJ      :yomN         hypothetical protein; phage SPbeta
Swiss-Prot:YOMN_BACSU   RecName: Full=SPBc2 prophage-derived uncharacterized protein yomN;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:139 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->115 PF04883 * DUF646 5.3e-05 15.0 80/106  
:BLT:SWISS 1->139 YOMN_BACSU 9e-78 100.0 %
:REPEAT 2|31->79|87->139

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14047.1 GT:GENE yomN GT:PRODUCT hypothetical protein; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2244714..2245133 GB:FROM 2244714 GB:TO 2245133 GB:DIRECTION + GB:GENE yomN GB:PRODUCT hypothetical protein; phage SPbeta GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB14047.1 GB:DB_XREF SubtiList:BG13601 UniProtKB/Swiss-Prot:O31970 GB:GENE:GENE yomN LENGTH 139 SQ:AASEQ MAKTIKDIKAMVEQAAIQSIHKSSSNVKQIMVKTGQEHIVEDVYGAYDPLLYERTGQVKDAFITTNESNGVSLDNIREDDGKDIATVIETGQGYTYPDSYGYGYGNPRPFMKNTSETLRDGRLTAALKKDLKADGIKTD GT:EXON 1|1-139:0| SW:ID YOMN_BACSU SW:DE RecName: Full=SPBc2 prophage-derived uncharacterized protein yomN; SW:GN Name=yomN; OrderedLocusNames=BSU21290; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->139|YOMN_BACSU|9e-78|100.0|139/139| NREPEAT 1 REPEAT 2|31->79|87->139| HM:PFM:NREP 1 HM:PFM:REP 10->115|PF04883|5.3e-05|15.0|80/106|DUF646| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-6, 137-139| PSIPRED cccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHccHHHHccccccEEEEEEcccccccccccccccccHHHHHHHcccccccccccccccccccccccccHHHHHccHHHHHHHHHHHccccccc //