[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yomT
DDBJ      :yomT         hypothetical protein; phage SPbeta
Swiss-Prot:YOMT_BACSU   RecName: Full=SPBc2 prophage-derived uncharacterized protein yomT;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->75 YOMT_BACSU 2e-34 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14041.1 GT:GENE yomT GT:PRODUCT hypothetical protein; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2241765..2241992 GB:FROM 2241765 GB:TO 2241992 GB:DIRECTION + GB:GENE yomT GB:PRODUCT hypothetical protein; phage SPbeta GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB14041.1 GB:DB_XREF SubtiList:BG13607 UniProtKB/Swiss-Prot:O31964 GB:GENE:GENE yomT LENGTH 75 SQ:AASEQ MTFDEVCGLFKQFDGLEQKFLLLSDGSYISVDDFKQRFEGDFNEYEPLSSLQSSPSSTPAWEGIWNKLQEDGLFE GT:EXON 1|1-75:0| SW:ID YOMT_BACSU SW:DE RecName: Full=SPBc2 prophage-derived uncharacterized protein yomT; SW:GN Name=yomT; OrderedLocusNames=BSU21230; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->75|YOMT_BACSU|2e-34|100.0|75/100| SEG 47->57|plsslqsspss| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 48-58| PSIPRED ccHHHHHHHHHHHccccHHEEEEccccEEcHHHHHHHHccccccccHHHHHHcccccccHHHHHHHHHHcccccc //