[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yopB
DDBJ      :yopB         putative transcriptional regulator; phage SPbeta
Swiss-Prot:YOPB_BACSU   RecName: Full=SPBc2 prophage-derived uncharacterized protein yopB;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
a.35.1
:75 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->69 3b7hA PDBj 2e-05 17.4 %
:RPS:SCOP  1->65 1b0nA2  a.35.1.3 * 1e-06 18.5 %
:HMM:SCOP  1->68 1b0nA2 a.35.1.3 * 7.8e-06 23.5 %
:HMM:PFM   4->46 PF01765 * RRF 0.00048 23.3 43/165  
:BLT:SWISS 1->75 YOPB_BACSU 2e-40 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14013.1 GT:GENE yopB GT:PRODUCT putative transcriptional regulator; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2214972..2215199) GB:FROM 2214972 GB:TO 2215199 GB:DIRECTION - GB:GENE yopB GB:PRODUCT putative transcriptional regulator; phage SPbeta GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr: putative regulator GB:PROTEIN_ID CAB14013.1 GB:DB_XREF SubtiList:BG13635 UniProtKB/Swiss-Prot:O31936 GB:GENE:GENE yopB LENGTH 75 SQ:AASEQ MIRSNLKSIIDERKISIRKLSRDIDHEYPTVRKLYNDEMERYPRDLLDKVCTYLNIELQELLIFEKSHNHIDHSG GT:EXON 1|1-75:0| SW:ID YOPB_BACSU SW:DE RecName: Full=SPBc2 prophage-derived uncharacterized protein yopB; SW:GN Name=yopB; OrderedLocusNames=BSU20950; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->75|YOPB_BACSU|2e-40|100.0|75/75| RP:PDB:NREP 1 RP:PDB:REP 1->69|3b7hA|2e-05|17.4|69/76| HM:PFM:NREP 1 HM:PFM:REP 4->46|PF01765|0.00048|23.3|43/165|RRF| RP:SCP:NREP 1 RP:SCP:REP 1->65|1b0nA2|1e-06|18.5|65/68|a.35.1.3| HM:SCP:REP 1->68|1b0nA2|7.8e-06|23.5|68/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 69 STR:RPRED 92.0 SQ:SECSTR HHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHcTTcccccHHHHHHHHHHHTccHHHHTccTTTTc###### DISOP:02AL 1-7, 69-75| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //