[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yopM
DDBJ      :yopM         hypothetical protein; phage SPbeta
Swiss-Prot:YOPM_BACSU   RecName: Full=SPBc2 prophage-derived uncharacterized protein yopM;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:66 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->63 PF07651 * ANTH 0.00035 17.5 57/279  
:BLT:SWISS 1->66 YOPM_BACSU 9e-34 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13976.1 GT:GENE yopM GT:PRODUCT hypothetical protein; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2208328..2208528) GB:FROM 2208328 GB:TO 2208528 GB:DIRECTION - GB:GENE yopM GB:PRODUCT hypothetical protein; phage SPbeta GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB13976.1 GB:DB_XREF SubtiList:BG13646 UniProtKB/Swiss-Prot:O34605 GB:GENE:GENE yopM LENGTH 66 SQ:AASEQ MSAISYLKNSMTMHKTIYQKKVESLVKNDLFFHEKSIEKSKIMKNENVRKQLTKGYMKLLSEYKED GT:EXON 1|1-66:0| SW:ID YOPM_BACSU SW:DE RecName: Full=SPBc2 prophage-derived uncharacterized protein yopM; SW:GN Name=yopM; OrderedLocusNames=BSU20840; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->66|YOPM_BACSU|9e-34|100.0|66/66| HM:PFM:NREP 1 HM:PFM:REP 5->63|PF07651|0.00035|17.5|57/279|ANTH| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-4, 6-7, 40-47, 64-66| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccc //