[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yopO
DDBJ      :yopO         putative transcriptional regulator; phage SPbeta
Swiss-Prot:YOPO_BACSU   RecName: Full=SPBc2 prophage-derived uncharacterized HTH-type transcriptional regulator yopO;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
a.35.1
:70 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->63 1b0nA PDBj 8e-04 28.6 %
:RPS:PDB   1->62 3dnvB PDBj 1e-06 22.6 %
:RPS:SCOP  1->61 1perL  a.35.1.2 * 2e-07 25.0 %
:HMM:SCOP  3->67 2b5aA1 a.35.1.3 * 1e-07 32.3 %
:HMM:PFM   5->59 PF01381 * HTH_3 1.6e-13 30.9 55/55  
:BLT:SWISS 1->70 YOPO_BACSU 2e-34 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13974.1 GT:GENE yopO GT:PRODUCT putative transcriptional regulator; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2207748..2207960) GB:FROM 2207748 GB:TO 2207960 GB:DIRECTION - GB:GENE yopO GB:PRODUCT putative transcriptional regulator; phage SPbeta GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr: putative regulator GB:PROTEIN_ID CAB13974.1 GB:DB_XREF GOA:O34791 InterPro:IPR001387 SubtiList:BG13648 UniProtKB/TrEMBL:O34791 GB:GENE:GENE yopO LENGTH 70 SQ:AASEQ MSERIKQLMVKRGITIEELSRETMIDMQTLNKIIEMPDESDVTTIKLIALVLNVSIDELLDEKGGEDNAK GT:EXON 1|1-70:0| SW:ID YOPO_BACSU SW:DE RecName: Full=SPBc2 prophage-derived uncharacterized HTH-type transcriptional regulator yopO; SW:GN Name=yopO; OrderedLocusNames=BSU20820; SW:KW Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->70|YOPO_BACSU|2e-34|100.0|70/70| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 1->63|1b0nA|8e-04|28.6|63/103| RP:PDB:NREP 1 RP:PDB:REP 1->62|3dnvB|1e-06|22.6|62/71| HM:PFM:NREP 1 HM:PFM:REP 5->59|PF01381|1.6e-13|30.9|55/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 1->61|1perL|2e-07|25.0|60/63|a.35.1.2| HM:SCP:REP 3->67|2b5aA1|1e-07|32.3|65/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 70 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHcGGGccHHHHHHHHHHTTcccccccccHHHHHcHH DISOP:02AL 1-7, 61-70| PSIPRED cHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHcccccccc //