[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yoqB
DDBJ      :yoqB         hypothetical protein; phage SPbeta
Swiss-Prot:YOQB_BACSU   RecName: Full=SPBc2 prophage-derived uncharacterized protein yoqB;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->112 YOQB_BACSU 9e-65 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13961.1 GT:GENE yoqB GT:PRODUCT hypothetical protein; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2200790..2201128) GB:FROM 2200790 GB:TO 2201128 GB:DIRECTION - GB:GENE yoqB GB:PRODUCT hypothetical protein; phage SPbeta GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB13961.1 GB:DB_XREF SubtiList:BG13661 UniProtKB/Swiss-Prot:O34831 GB:GENE:GENE yoqB LENGTH 112 SQ:AASEQ MKEFHLHKYPVTSVEGNEYAVSIYNDRHSKGFVKVSLYKKVRGFFRKEKFKCLTREGDFAPSYFEEKWDYDYIQMAINEVINYENSIKEQINHENKQKAAIEKFEAWSGQEV GT:EXON 1|1-112:0| SW:ID YOQB_BACSU SW:DE RecName: Full=SPBc2 prophage-derived uncharacterized protein yoqB; SW:GN Name=yoqB; OrderedLocusNames=BSU20690; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->112|YOQB_BACSU|9e-65|100.0|112/112| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-4, 90-98, 111-112| PSIPRED cccccccccccccccccEEEEEEEcccccccEEEHHHHHHHHHHHHHHHHHHHcccccccccHHHHcccHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHccccccc //