[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yoqG
DDBJ      :yoqG         hypothetical protein; phage SPbeta
Swiss-Prot:YOQG_BACSU   RecName: Full=SPBc2 prophage-derived uncharacterized protein yoqG;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->85 YOQG_BACSU 2e-48 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13956.1 GT:GENE yoqG GT:PRODUCT hypothetical protein; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2198848..2199105) GB:FROM 2198848 GB:TO 2199105 GB:DIRECTION - GB:GENE yoqG GB:PRODUCT hypothetical protein; phage SPbeta GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB13956.1 GB:DB_XREF SubtiList:BG13666 UniProtKB/Swiss-Prot:O35030 GB:GENE:GENE yoqG LENGTH 85 SQ:AASEQ MEKMNLLKEITIFDLNKIKPGTKVQVTWYKGTEMEYTHNGEVIINNGEKFYYNYVDKEGYVGHCHVNALDLKNYPDSLIVEIKSK GT:EXON 1|1-85:0| SW:ID YOQG_BACSU SW:DE RecName: Full=SPBc2 prophage-derived uncharacterized protein yoqG; SW:GN Name=yoqG; OrderedLocusNames=BSU20640; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->85|YOQG_BACSU|2e-48|100.0|85/100| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-5| PSIPRED cccHHHHHEEEEEEccccccccEEEEEEEcccEEEEEccccEEEEcccEEEEEEEcccccEEEEEEEEEEccccccEEEEEEEcc //