[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yoqJ
DDBJ      :yoqJ         conserved hypothetical protein; phage SPbeta
Swiss-Prot:YOQJ_BACSU   RecName: Full=Uncharacterized SPBc2 prophage-derived protein yoqJ;

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->137 2nx2A PDBj 1e-11 30.7 %
:RPS:PFM   9->146 PF06908 * DUF1273 8e-21 45.1 %
:HMM:PFM   7->163 PF06908 * DUF1273 1.5e-46 34.7 147/177  
:BLT:SWISS 1->171 YOQJ_BACSU e-101 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13953.1 GT:GENE yoqJ GT:PRODUCT conserved hypothetical protein; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2197344..2197859) GB:FROM 2197344 GB:TO 2197859 GB:DIRECTION - GB:GENE yoqJ GB:PRODUCT conserved hypothetical protein; phage SPbeta GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13953.1 GB:DB_XREF InterPro:IPR010697 SubtiList:BG13669 UniProtKB/Swiss-Prot:O34359 GB:GENE:GENE yoqJ LENGTH 171 SQ:AASEQ MKNPTMLKLKDKLLAVIEELITKENKYRFITGGALGTDQAACWCVHILKKKHPHIKNIIATPFKEQDKVWSADQKMWYKRMLNVADEIINVEELDKYKVSGEKPGEFSPAKMQKRNEYMIDHSEAIVAVYDGSKSGTRNCLNYAKKTYLGHQLWRLHPDFNFELDITYFVG GT:EXON 1|1-171:0| SW:ID YOQJ_BACSU SW:DE RecName: Full=Uncharacterized SPBc2 prophage-derived protein yoqJ; SW:GN Name=yoqJ; OrderedLocusNames=BSU20610; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->171|YOQJ_BACSU|e-101|100.0|171/171| BL:PDB:NREP 1 BL:PDB:REP 9->137|2nx2A|1e-11|30.7|114/178| RP:PFM:NREP 1 RP:PFM:REP 9->146|PF06908|8e-21|45.1|122/169|DUF1273| HM:PFM:NREP 1 HM:PFM:REP 7->163|PF06908|1.5e-46|34.7|147/177|DUF1273| OP:NHOMO 24 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-111111-1---2111-----1--------------------------------------------------------------------------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 114 STR:RPRED 66.7 SQ:SECSTR ########HHHHHHHHHTTTccE#####EEEcccTTHHHHHHHHHHTTTTTcTTcEEEEEEccccTTTTccHHHHHHHHHHHHHcc##########EEEEccccccccHHHHHHHHHHHHHHccEEEEEccTTTccT################################## DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHcccHHHHHcccccccccccccccccHHHHHHHHHHHHHHcEEEEEEcccccccccHHHHHHHHHHccHHHHccccccEEEEEEEEEc //