[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yoqY
DDBJ      :yoqY         hypothetical protein; phage SPbeta
Swiss-Prot:YOQY_BACSU   RecName: Full=SPBc2 prophage-derived uncharacterized protein yoqY;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->79 1r88A PDBj 9e-05 38.9 %
:BLT:PDB   70->112 1kflA PDBj 8e-04 37.2 %
:HMM:PFM   25->81 PF12228 * DUF3604 0.00059 21.1 57/592  
:BLT:SWISS 1->131 YOQY_BACSU 3e-74 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13939.1 GT:GENE yoqY GT:PRODUCT hypothetical protein; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2190884..2191279) GB:FROM 2190884 GB:TO 2191279 GB:DIRECTION - GB:GENE yoqY GB:PRODUCT hypothetical protein; phage SPbeta GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB13939.1 GB:DB_XREF SubtiList:BG13683 UniProtKB/Swiss-Prot:O31914 GB:GENE:GENE yoqY LENGTH 131 SQ:AASEQ MNLYEIMLEHFAPKGSERGIFTYLLAQSDEEVYEWLKTDPSLSDGRAVYTPYQDNEANGKTYAIYNQSFDIVGHEKYKDRMIRLKGELNDEVELTDLYYGMTLVGWSMVKSDIPSEQIELLKDTGISIESA GT:EXON 1|1-131:0| SW:ID YOQY_BACSU SW:DE RecName: Full=SPBc2 prophage-derived uncharacterized protein yoqY; SW:GN Name=yoqY; OrderedLocusNames=BSU20470; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->131|YOQY_BACSU|3e-74|100.0|131/131| BL:PDB:NREP 2 BL:PDB:REP 24->79|1r88A|9e-05|38.9|54/267| BL:PDB:REP 70->112|1kflA|8e-04|37.2|43/342| HM:PFM:NREP 1 HM:PFM:REP 25->81|PF12228|0.00059|21.1|57/592|DUF3604| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 87 STR:RPRED 66.4 SQ:SECSTR #######################HHHHTTcEEEEEcccccccccGGGGTT##cHHHHHHHHHHHHHHHHHTTcccEEEEHHHHHHHHGGGTEEEEEcccccccccccHHHHc################### DISOP:02AL 130-131| PSIPRED ccHHHHHHHHHccccccccEEEEEEEcccHHHHHHHHccccccccEEEEcccccccccccEEEEEcccccEEccHHHHHHEEEEEccccccEEEHHHHHHHHHHHHHHHHccccHHHHHHHHHcccEEEcc //