[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yorD
DDBJ      :yorD         hypothetical protein; phage SPbeta
Swiss-Prot:SCP1_BPSPC   RecName: Full=Stress response protein SCP1;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
d.186.2
:104 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  19->59 2hg7A1  d.186.2.1 * 8e-12 40.0 %
:RPS:PFM   22->92 PF09636 * XkdW 5e-06 35.2 %
:HMM:PFM   19->91 PF09636 * XkdW 8.5e-08 28.8 73/108  
:BLT:SWISS 1->104 SCP1_BPSPC 2e-49 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13934.1 GT:GENE yorD GT:PRODUCT hypothetical protein; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2186985..2187299) GB:FROM 2186985 GB:TO 2187299 GB:DIRECTION - GB:GENE yorD GB:PRODUCT hypothetical protein; phage SPbeta GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB13934.1 GB:DB_XREF GOA:P68575 SubtiList:BG13688 UniProtKB/Swiss-Prot:P68575 GB:GENE:GENE yorD LENGTH 104 SQ:AASEQ MEFKVGQDVSEIWNIHGSILPEVLMYMFPRSDESYDWEFVNDNGRHIFTAWRKSEPIPTLEEIEKAAIELEEKKNAPKPKTLEERVADLEKQVAYLTSKVEGTN GT:EXON 1|1-104:0| SW:ID SCP1_BPSPC SW:DE RecName: Full=Stress response protein SCP1; SW:GN Name=yorD; OrderedLocusNames=SPBc2p126; SW:KW Cytoplasm; Stress response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->104|SCP1_BPSPC|2e-49|100.0|104/104| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006950|"GO:response to stress"|Stress response| SEG 60->73|leeiekaaieleek| RP:PFM:NREP 1 RP:PFM:REP 22->92|PF09636|5e-06|35.2|71/106|XkdW| HM:PFM:NREP 1 HM:PFM:REP 19->91|PF09636|8.5e-08|28.8|73/108|XkdW| RP:SCP:NREP 1 RP:SCP:REP 19->59|2hg7A1|8e-12|40.0|40/60|d.186.2.1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-5, 69-83, 101-104| PSIPRED ccccccccHHHHHHccHHHHHHHHHHHccccccccccEEEcccccEEEEEcccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccc //