[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yorM
DDBJ      :yorM         conserved hypothetical protein; phage SPbeta
Swiss-Prot:YORM_BACSU   RecName: Full=SPBc2 prophage-derived uncharacterized protein yorM;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  63/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
c.47.1
:238 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   127->236 2ae0X PDBj 1e-17 19.2 %
:RPS:SCOP  123->234 1a8yA3  c.47.1.3 * 9e-20 17.6 %
:RPS:PFM   178->236 PF06725 * 3D 7e-09 55.9 %
:HMM:PFM   176->236 PF06725 * 3D 1.2e-18 57.4 61/75  
:HMM:PFM   71->123 PF05132 * RNA_pol_Rpc4 0.00068 20.0 40/131  
:BLT:SWISS 1->238 YORM_BACSU e-120 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13925.1 GT:GENE yorM GT:PRODUCT conserved hypothetical protein; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2174852..2175568) GB:FROM 2174852 GB:TO 2175568 GB:DIRECTION - GB:GENE yorM GB:PRODUCT conserved hypothetical protein; phage SPbeta GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13925.1 GB:DB_XREF GOA:O31901 InterPro:IPR010611 SubtiList:BG13697 UniProtKB/Swiss-Prot:O31901 GB:GENE:GENE yorM LENGTH 238 SQ:AASEQ MFKKLIDKHKKYVYHRINKMALFATIGLLGVGLVYSAKNLYTHQDNQVSIKKSFYLNKKEVRQKLIHEIDVPRILPRLKSEEEKQAESRKKYLNATITYLTEENKKAAKHTKTKKVQKTNTKRNLDKAVSKSTNAKAVKSHEVVATAYTAFCSTGCTGKTRTGYDVSNTSYYNGKRIIAVDPEVIPLYSLVQVSYEGNSFQAYAIDTGGDIKNNRIDILMDSEQEANAFGRKNVRVSW GT:EXON 1|1-238:0| SW:ID YORM_BACSU SW:DE RecName: Full=SPBc2 prophage-derived uncharacterized protein yorM;Flags: Precursor; SW:GN Name=yorM; OrderedLocusNames=BSU20330; SW:KW Complete proteome; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->238|YORM_BACSU|e-120|100.0|238/238| SEG 101->122|teenkkaakhtktkkvqktntk| RP:PDB:NREP 1 RP:PDB:REP 127->236|2ae0X|1e-17|19.2|104/335| RP:PFM:NREP 1 RP:PFM:REP 178->236|PF06725|7e-09|55.9|59/70|3D| HM:PFM:NREP 2 HM:PFM:REP 176->236|PF06725|1.2e-18|57.4|61/75|3D| HM:PFM:REP 71->123|PF05132|0.00068|20.0|40/131|RNA_pol_Rpc4| GO:PFM:NREP 3 GO:PFM GO:0004553|"GO:hydrolase activity, hydrolyzing O-glycosyl compounds"|PF06725|IPR010611| GO:PFM GO:0009254|"GO:peptidoglycan turnover"|PF06725|IPR010611| GO:PFM GO:0019867|"GO:outer membrane"|PF06725|IPR010611| RP:SCP:NREP 1 RP:SCP:REP 123->234|1a8yA3|9e-20|17.6|108/112|c.47.1.3| OP:NHOMO 134 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------124444444424434543233234431-12334111111----------------------1----------------------------------------------------------------------1-1-111111111-1111-1-1-1--11---1---1------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 104 STR:RPRED 43.7 SQ:SECSTR ##############################################################################################################################HHHHHTccHHHHHHHHTTccccEEEEEEccccccTTcccc######cTTcEEEccTTTccTTcEEEEEEEEEEEEEEEEEccTTccTTcEEEEEEEcHHHHHcccEEEEE## DISOP:02AL 1-3, 5-7, 71-139| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEccccEEEEEEccEEEEEEEEEEEEEEEEEEEccHHHHHHHHHHHHcccEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEEEEEcccccccccccccccccccccccccccEEEEEcccccccccEEEEEEcccccEEEEEEccccccccEEEEEEccHHHHHHcccEEEEEEc //