[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yorT
DDBJ      :yorT         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:39 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->38 PF05812 * Herpes_BLRF2 0.00037 30.6 36/118  
:BLT:SWISS 1->39 YORT_BACSU 2e-18 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13918.1 GT:GENE yorT GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2172781..2172900) GB:FROM 2172781 GB:TO 2172900 GB:DIRECTION - GB:GENE yorT GB:PRODUCT hypothetical protein GB:FUNCTION 18: Unknown function GB:NOTE Evidence 6: Doubtful CDS GB:PROTEIN_ID CAB13918.1 GB:DB_XREF SubtiList:BG13704 UniProtKB/Swiss-Prot:O31894 GB:GENE:GENE yorT LENGTH 39 SQ:AASEQ MERFIKRLSASCESTIHHKVYQIMNEAKTEFEKVLKKLK GT:EXON 1|1-39:0| BL:SWS:NREP 1 BL:SWS:REP 1->39|YORT_BACSU|2e-18|100.0|39/100| HM:PFM:NREP 1 HM:PFM:REP 3->38|PF05812|0.00037|30.6|36/118|Herpes_BLRF2| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-3| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //