[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yosC
DDBJ      :yosC         conserved hypothetical protein; phage SPbeta
Swiss-Prot:YOSC_BACSU   RecName: Full=SPBc2 prophage-derived uncharacterized protein yosC;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:180 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->91 PF00647 * EF1G 0.00044 32.0 50/107  
:BLT:SWISS 1->180 YOSC_BACSU e-105 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13909.1 GT:GENE yosC GT:PRODUCT conserved hypothetical protein; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2168910..2169452) GB:FROM 2168910 GB:TO 2169452 GB:DIRECTION - GB:GENE yosC GB:PRODUCT conserved hypothetical protein; phage SPbeta GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13909.1 GB:DB_XREF SubtiList:BG13712 UniProtKB/Swiss-Prot:O31886 GB:GENE:GENE yosC LENGTH 180 SQ:AASEQ MISRASAVYDKLKQAERNIRGDESMQTLDAPIYEVKQESDWYKSEKKRKEDINSFFDKFEEKYGVKEGFSFYHSEYFGVYEGTEAYEIFKNDIVKNQVDGFYAFKKRSKYFKEIKAMIEQIEEVYPFRSHDELGLNNMTGRQWIGDRWFFGVKTEQLVNGDSVVATDYKDYLKIVMEHLD GT:EXON 1|1-180:0| SW:ID YOSC_BACSU SW:DE RecName: Full=SPBc2 prophage-derived uncharacterized protein yosC; SW:GN Name=yosC; OrderedLocusNames=BSU20170; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->180|YOSC_BACSU|e-105|100.0|180/180| HM:PFM:NREP 1 HM:PFM:REP 32->91|PF00647|0.00044|32.0|50/107|EF1G| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-6, 16-20, 40-50| PSIPRED cccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHcccccEEcccHHHHHccccEEEccHHHHHHHHHHHcc //