[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yosW
DDBJ      :yosW         conserved hypothetical protein; phage SPbeta
Swiss-Prot:YOSW_BACSU   RecName: Full=SPBc2 prophage-derived uncharacterized membrane protein yosW;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->113 YOSW_BACSU 4e-61 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13889.1 GT:GENE yosW GT:PRODUCT conserved hypothetical protein; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2157341..2157682) GB:FROM 2157341 GB:TO 2157682 GB:DIRECTION - GB:GENE yosW GB:PRODUCT conserved hypothetical protein; phage SPbeta GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13889.1 GB:DB_XREF GOA:O31872 SubtiList:BG13732 UniProtKB/Swiss-Prot:O31872 GB:GENE:GENE yosW LENGTH 113 SQ:AASEQ MIMRGESNTYIKVKSVLDNSTPEDAKRNKNLIYLFTLLKGSSLIIPLAYNGLIMHENILILCWTAFSVIYTVLSMFKVLDVLEGETVSHSRYIYLAYVFGNLIFALSIIFHIM GT:EXON 1|1-113:0| SW:ID YOSW_BACSU SW:DE RecName: Full=SPBc2 prophage-derived uncharacterized membrane protein yosW; SW:GN Name=yosW; OrderedLocusNames=BSU19980; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->113|YOSW_BACSU|4e-61|100.0|113/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 3 TM:REGION 29->51| TM:REGION 57->79| TM:REGION 87->109| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-7, 20-25| PSIPRED cEEEcccccEEEEEEHHcccccccHHHcccEEEEEEEEcccEEEEEEEcccEEEEccEEEEHHHHHHHHHHHHHHHHHHHHHcccccccccEEEHHHHHHHHHHHHHHHHHcc //