[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yosX
DDBJ      :yosX         conserved hypothetical protein; phage SPbeta
Swiss-Prot:YOSX_BPSPC   RecName: Full=Uncharacterized protein yosX;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->23 PF08946 * Osmo_CC 0.00045 47.4 19/46  
:HMM:PFM   17->51 PF11201 * DUF2982 0.00098 37.1 35/153  
:BLT:SWISS 1->117 YOSX_BPSPC 2e-63 100.0 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13888.1 GT:GENE yosX GT:PRODUCT conserved hypothetical protein; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2156757..2157110) GB:FROM 2156757 GB:TO 2157110 GB:DIRECTION - GB:GENE yosX GB:PRODUCT conserved hypothetical protein; phage SPbeta GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13888.1 GB:DB_XREF SubtiList:BG13733 UniProtKB/Swiss-Prot:P68583 GB:GENE:GENE yosX LENGTH 117 SQ:AASEQ MEVGDKIHNTNEQITALEKKKYQIETTLLEKQRDLLKLETQQNKAKLELLFELSEVLTQLEGEEWVSATIALRIIKRNKRKYLDLFDLNDDKAYVNKDKFKFLHDEFFELKQQLNDI GT:EXON 1|1-117:0| SW:ID YOSX_BPSPC SW:DE RecName: Full=Uncharacterized protein yosX; SW:GN Name=yosX; OrderedLocusNames=SPBc2p171; SW:KW Coiled coil. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->117|YOSX_BPSPC|2e-63|100.0|117/117| COIL:NAA 32 COIL:NSEG 1 COIL:REGION 15->46| HM:PFM:NREP 2 HM:PFM:REP 5->23|PF08946|0.00045|47.4|19/46|Osmo_CC| HM:PFM:REP 17->51|PF11201|0.00098|37.1|35/153|DUF2982| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-3, 116-117| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHEEEEEcccccHHHcHHHHHHHHHHHHHHHHHHccc //