[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yotB
DDBJ      :yotB         putative metallo-dependent hydrolase; phage SPbeta
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
d.159.1
:275 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->260 3c9fB PDBj 8e-08 15.8 %
:RPS:SCOP  1->251 2nxfA1  d.159.1.12 * 9e-07 13.6 %
:HMM:SCOP  1->250 4kbpA2 d.159.1.1 * 1.5e-17 17.8 %
:HMM:PFM   1->226 PF00149 * Metallophos 2.5e-20 10.2 186/200  
:BLT:SWISS 5->251 YL509_MIMIV 2e-06 25.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13885.1 GT:GENE yotB GT:PRODUCT putative metallo-dependent hydrolase; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2155293..2156120) GB:FROM 2155293 GB:TO 2156120 GB:DIRECTION - GB:GENE yotB GB:PRODUCT putative metallo-dependent hydrolase; phage SPbeta GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB13885.1 GB:DB_XREF GOA:O34642 InterPro:IPR004843 SubtiList:BG13735 UniProtKB/TrEMBL:O34642 GB:GENE:GENE yotB LENGTH 275 SQ:AASEQ MKIDYVSDLHINHWIPWNVNQIKWEKRTREIVNRLISNGNGEVLVIAGDFTEWNQQTLWVLDEAAKQYEKVYFTYGNHDLYLLSKSQKRKYSDSLGRLNDLIQKAADMKNVTPLIKTTETYKGKVFAGDVMWYLPKGIEGWDFFKGVSNDSNYIWLNGYNKVDGVRAMWKESMDWYETLENTQVDVFVSHVPPVHNPYSPFEPNTCYMVDVPFINAKHWVCGHDHLQAEFDKDGTSFHMNCIGYPYDYDNYPSVNVIPGEEVDSYKTFELKTFEI GT:EXON 1|1-275:0| BL:SWS:NREP 1 BL:SWS:REP 5->251|YL509_MIMIV|2e-06|25.2|226/100| RP:PDB:NREP 1 RP:PDB:REP 1->260|3c9fB|8e-08|15.8|247/540| HM:PFM:NREP 1 HM:PFM:REP 1->226|PF00149|2.5e-20|10.2|186/200|Metallophos| RP:SCP:NREP 1 RP:SCP:REP 1->251|2nxfA1|9e-07|13.6|243/314|d.159.1.12| HM:SCP:REP 1->250|4kbpA2|1.5e-17|17.8|208/0|d.159.1.1|1/1|Metallo-dependent phosphatases| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 275 STR:RPRED 100.0 SQ:SECSTR EEEEEEcccTTcTTccGcccHHHHHHHHHHHHHHHHHTTcEEEEEEccccccccHHHHccccTTTTTHHHcEEcccGGGTcHHHHHHHGGcHHHHHHHHHTHHHHTTTTcccccEEEEcTTccEEEcccccEEEEcTTTccEEEEEEcccccccccTTEEEccHHHHTTcHHHHHHHHHTTccccEEEEEcccccTTTcHHHHHHHHHHHHcTTcEEEEEEcccccEEEEEEETTEEEEEEccTTccEEEEEEEccccGGcccEEEEEEEETTEE DISOP:02AL 274-276| PSIPRED cEEEEEEEEcccccccccccccccccHHHHHHHHccccccccEEEEEcccccccHHHHHHHHHHHHHccEEEEEccccHHccccccHHHHHHHHHccHHHHHHHHcccccEEEcccccEEEccEEEEEEEcccccccHHHHHHHHHHccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccHHHHHHccEEccEEccEEEEEEccEEEEEEccccccccccccEEEEEccccccccEEEEEEEEEc //