[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yotD
DDBJ      :yotD         hypothetical protein; phage SPbeta
Swiss-Prot:YOTD_BACSU   RecName: Full=SPBc2 prophage-derived uncharacterized protein yotD;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:43 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->36 PF01155 * HypA 7e-06 22.6 31/113  
:BLT:SWISS 1->43 YOTD_BACSU 2e-24 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13883.1 GT:GENE yotD GT:PRODUCT hypothetical protein; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2154887..2155018) GB:FROM 2154887 GB:TO 2155018 GB:DIRECTION - GB:GENE yotD GB:PRODUCT hypothetical protein; phage SPbeta GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB13883.1 GB:DB_XREF SubtiList:BG13737 UniProtKB/Swiss-Prot:O34407 GB:GENE:GENE yotD LENGTH 43 SQ:AASEQ MDSREQIDWTCNECNFSWIGDNSDFSCPSCDEIDIKPKNKILD GT:EXON 1|1-43:0| SW:ID YOTD_BACSU SW:DE RecName: Full=SPBc2 prophage-derived uncharacterized protein yotD; SW:GN Name=yotD; Synonyms=yokD; OrderedLocusNames=BSU19920; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->43|YOTD_BACSU|2e-24|100.0|43/43| HM:PFM:NREP 1 HM:PFM:REP 6->36|PF01155|7e-06|22.6|31/113|HypA| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-3, 41-43| PSIPRED ccccccccEEEccccEEEEcccccccccccccccccccccccc //