[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yozC
DDBJ      :yozC         conserved hypothetical protein
Swiss-Prot:YOZC_BACSU   RecName: Full=Uncharacterized protein yozC;

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:67 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->49 PF08360 * TetR_C_5 0.00031 19.6 46/131  
:BLT:SWISS 1->67 YOZC_BACSU 8e-37 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13822.1 GT:GENE yozC GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2100147..2100350) GB:FROM 2100147 GB:TO 2100350 GB:DIRECTION - GB:GENE yozC GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13822.1 GB:DB_XREF SubtiList:BG13750 UniProtKB/Swiss-Prot:O31848 GB:GENE:GENE yozC LENGTH 67 SQ:AASEQ MIHKNWLEKETIKKVKCVQTNAKKYIVNRVLTPGKEYEVKNETEEFLFVVDNTNKVGGYYKEYFEEM GT:EXON 1|1-67:0| SW:ID YOZC_BACSU SW:DE RecName: Full=Uncharacterized protein yozC; SW:GN Name=yozC; OrderedLocusNames=BSU19300; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->67|YOZC_BACSU|8e-37|100.0|67/67| HM:PFM:NREP 1 HM:PFM:REP 4->49|PF08360|0.00031|19.6|46/131|TetR_C_5| OP:NHOMO 32 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------111111---11111-----------1111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccccccccccEEEEEEEccccEEEEccccccccEEcccccccEEEEEEEcccccccHHHHHHHcc //