[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yozE
DDBJ      :yozE         conserved hypothetical protein
Swiss-Prot:YOZE_BACSU   RecName: Full=UPF0346 protein yozE;

Homologs  Archaea  0/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.60.15
:74 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->74 2fj6A PDBj 5e-43 100.0 %
:RPS:SCOP  1->74 2fj6A1  a.60.15.1 * 5e-14 100.0 %
:HMM:SCOP  1->74 2fj6A1 a.60.15.1 * 3.8e-27 56.8 %
:RPS:PFM   24->67 PF06855 * DUF1250 2e-08 61.4 %
:HMM:PFM   23->68 PF06855 * DUF1250 6.3e-26 60.9 46/46  
:BLT:SWISS 1->74 YOZE_BACSU 1e-42 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13859.1 GT:GENE yozE GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2138868..2139092) GB:FROM 2138868 GB:TO 2139092 GB:DIRECTION - GB:GENE yozE GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13859.1 GB:DB_XREF InterPro:IPR017161 PDB:2FJ6 SubtiList:BG13752 UniProtKB/Swiss-Prot:O31864 GB:GENE:GENE yozE LENGTH 74 SQ:AASEQ MKSFYHYLLKYRHPKPKDSISEFANQAYEDHSFPKTSTDYHEISSYLELNADYLHTMATFDEAWDQYESEVHGR GT:EXON 1|1-74:0| SW:ID YOZE_BACSU SW:DE RecName: Full=UPF0346 protein yozE; SW:GN Name=yozE; OrderedLocusNames=BSU19680; SW:KW 3D-structure; Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->74|YOZE_BACSU|1e-42|100.0|74/74| BL:PDB:NREP 1 BL:PDB:REP 1->74|2fj6A|5e-43|100.0|74/82| RP:PFM:NREP 1 RP:PFM:REP 24->67|PF06855|2e-08|61.4|44/46|DUF1250| HM:PFM:NREP 1 HM:PFM:REP 23->68|PF06855|6.3e-26|60.9|46/46|DUF1250| RP:SCP:NREP 1 RP:SCP:REP 1->74|2fj6A1|5e-14|100.0|74/74|a.60.15.1| HM:SCP:REP 1->74|2fj6A1|3.8e-27|56.8|74/0|a.60.15.1|1/1|YozE-like| OP:NHOMO 88 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111--11111-111111--111111----------------------111111111111111111111111111-11---11-1--111-1--111111111111111--111---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 100.0 SQ:SECSTR ccTHHHHHHTTcccccccHHHHHHHHHHTcTTccTTcccHHHHHHHHHTcHHHHTTHHHHHHHHHHHHHHHTTT DISOP:02AL 72-74| PSIPRED cHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHccc //