[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yozJ
DDBJ      :yozJ         hypothetical protein
Swiss-Prot:YOZJ_BACSU   RecName: Full=Uncharacterized protein yozJ;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:151 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->151 YOZJ_BACSU 2e-86 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13782.1 GT:GENE yozJ GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2060237..2060692) GB:FROM 2060237 GB:TO 2060692 GB:DIRECTION - GB:GENE yozJ GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB13782.1 GB:DB_XREF SubtiList:BG13757 UniProtKB/Swiss-Prot:O31839 GB:GENE:GENE yozJ LENGTH 151 SQ:AASEQ MADRYVLIEVNEDGEGRLKDEAVTWIDFRLSIVDFNASEGLNQLMEQISKDVKDELVLVLFNYRVKSSYDSWSGATEYEDFFDVEFFKVIKKNYKKFYQGLVTVELDVGINGFDNIESMPTDSNQNYYRNLIAEWEEFYNEDFIPLSLNKR GT:EXON 1|1-151:0| SW:ID YOZJ_BACSU SW:DE RecName: Full=Uncharacterized protein yozJ; SW:GN Name=yozJ; OrderedLocusNames=BSU18900; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->151|YOZJ_BACSU|2e-86|100.0|151/151| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 150-151| PSIPRED ccccEEEEEEcccccccccccEEEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHEEEHEEccEEcccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHccccEEEEcccc //