[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ypbD
DDBJ      :ypbD         putative membrane protease
Swiss-Prot:YPBD_BACSU   RecName: Full=Uncharacterized protein ypbD;

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   80->161 PF02517 * Abi 9.3e-15 20.7 82/99  
:HMM:PFM   30->66 PF02508 * Rnf-Nqr 0.00024 36.1 36/190  
:BLT:SWISS 19->189 YPBD_BACSU 2e-98 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14217.1 GT:GENE ypbD GT:PRODUCT putative membrane protease GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2406293..2406862) GB:FROM 2406293 GB:TO 2406862 GB:DIRECTION - GB:GENE ypbD GB:PRODUCT putative membrane protease GB:FUNCTION 16.6: Maintain 16.3: Control GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pe: putative enzyme GB:PROTEIN_ID CAB14217.1 GB:DB_XREF GOA:P50730 InterPro:IPR003675 SubtiList:BG11430 UniProtKB/Swiss-Prot:P50730 GB:GENE:GENE ypbD LENGTH 189 SQ:AASEQ MTQLLIIFAAAAAGLFFFEDVRDVLKLWDIRDMRIIWYGVSIAVIVILADMAVMKWFPSHLYDDGGINKKIFSKRSIPHIIFLTLLIAFAEEMLFRGVLQTHIGLWTASLIFAALHFRYLSKWLLFIMVTAISFLLGLMYEWTGNLFVPMTAHFIIDAVFACQIRFEHVRRDKHDEHVESREKKSPESL GT:EXON 1|1-189:0| SW:ID YPBD_BACSU SW:DE RecName: Full=Uncharacterized protein ypbD; SW:GN Name=ypbD; OrderedLocusNames=BSU23010; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 19->189|YPBD_BACSU|2e-98|100.0|171/189| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 4->26| TM:REGION 32->54| TM:REGION 76->98| TM:REGION 113->135| SEG 4->18|lliifaaaaaglfff| HM:PFM:NREP 2 HM:PFM:REP 80->161|PF02517|9.3e-15|20.7|82/99|Abi| HM:PFM:REP 30->66|PF02508|0.00024|36.1|36/190|Rnf-Nqr| OP:NHOMO 38 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------1--------------------------------------------1----------1----------------------------11111111111111111111111111111-1--------11---------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 170-189| PSIPRED cHHHHHHHHHHHHHHHHHccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccc //