[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ypfD
DDBJ      :ypfD         RNA degradation presenting factor (ribosomal protein S1 homolog)
Swiss-Prot:RS1H_BACSU   RecName: Full=30S ribosomal protein S1 homolog;

Homologs  Archaea  11/68 : Bacteria  883/915 : Eukaryota  119/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:382 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   185->257 1sroA PDBj 2e-12 51.4 %
:BLT:PDB   270->348 2oceA PDBj 3e-16 50.0 %
:RPS:PDB   13->104 2cqoA PDBj 8e-05 19.8 %
:RPS:PDB   124->346 3bzcA PDBj 2e-23 21.0 %
:RPS:SCOP  14->56 2id0A1  b.40.4.5 * 2e-05 11.6 %
:RPS:SCOP  168->280 1wi5A  b.40.4.5 * 2e-16 17.7 %
:RPS:SCOP  269->343 1sroA  b.40.4.5 * 1e-19 50.0 %
:HMM:SCOP  14->110 1wi5A_ b.40.4.5 * 1.7e-19 41.2 %
:HMM:SCOP  88->168 1q46A2 b.40.4.5 * 7.3e-17 30.9 %
:HMM:SCOP  185->269 1go3E1 b.40.4.5 * 1.4e-29 52.9 %
:HMM:SCOP  251->348 1wi5A_ b.40.4.5 * 5.4e-30 45.4 %
:RPS:PFM   185->254 PF00575 * S1 1e-09 46.5 %
:RPS:PFM   270->340 PF00575 * S1 1e-10 45.1 %
:HMM:PFM   13->83 PF00575 * S1 1.7e-18 47.1 70/74  
:HMM:PFM   99->167 PF00575 * S1 2.1e-17 34.8 69/74  
:HMM:PFM   185->256 PF00575 * S1 2e-29 50.0 72/74  
:HMM:PFM   270->342 PF00575 * S1 1.1e-26 43.8 73/74  
:BLT:SWISS 1->382 RS1H_BACSU 0.0 100.0 %
:REPEAT 3|10->91|180->262|265->348
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14204.1 GT:GENE ypfD GT:PRODUCT RNA degradation presenting factor (ribosomal protein S1 homolog) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2394664..2395812) GB:FROM 2394664 GB:TO 2395812 GB:DIRECTION - GB:GENE ypfD GB:PRODUCT RNA degradation presenting factor (ribosomal protein S1 homolog) GB:FUNCTION 16.6: Maintain 16.3: Control 16.11: Scavenge (Catabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 14586115, 9179491, 9862121; Product type f : factor GB:PROTEIN_ID CAB14204.1 GB:DB_XREF GOA:P38494 HSSP:1SRO InterPro:IPR000110 SubtiList:BG11005 UniProtKB/Swiss-Prot:P38494 GB:GENE:GENE ypfD LENGTH 382 SQ:AASEQ MTEEMNQIDVQVPEVGDVVKGIVTKVEDKHVDVEIINVKQSGIIPISELSSLHVEKASDVVKVDDELDLKVTKVEDDALILSKRAVDADRAWEDLEKKFETKEVFEAEVKDVVKGGLVVDIGVRGFIPASLVEAHFVEDFTDYKGKTLSLLVVELDRDKNRVILSHRAVVESEQANKKQELLQSLEVGSVLDGKVQRLTDFGAFVDIGGIDGLVHISQLSHSHVEKPSDVVEEGQEVKVKVLSVDRDNERISLSIKDTLPGPWNQIGEKVKPGDVLEGTVQRLVSFGAFVEILPGVEGLVHISQISNKHIGTPHEVLEEGQTVKVKVLDVNENEERISLSMRELEETPKADQEDYRQYQAKEETSTGFQLGDLIGDKLNKLK GT:EXON 1|1-382:0| SW:ID RS1H_BACSU SW:DE RecName: Full=30S ribosomal protein S1 homolog; SW:GN Name=ypfD; Synonyms=jofD; OrderedLocusNames=BSU22880; SW:KW Complete proteome; Phosphoprotein; Repeat; Ribonucleoprotein;Ribosomal protein; RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->382|RS1H_BACSU|0.0|100.0|382/382| GO:SWS:NREP 3 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| NREPEAT 1 REPEAT 3|10->91|180->262|265->348| SEG 59->74|dvvkvddeldlkvtkv| SEG 109->123|vkdvvkgglvvdigv| SEG 230->241|vveegqevkvkv| BL:PDB:NREP 2 BL:PDB:REP 185->257|1sroA|2e-12|51.4|72/76| BL:PDB:REP 270->348|2oceA|3e-16|50.0|78/729| RP:PDB:NREP 2 RP:PDB:REP 13->104|2cqoA|8e-05|19.8|91/119| RP:PDB:REP 124->346|3bzcA|2e-23|21.0|219/730| RP:PFM:NREP 2 RP:PFM:REP 185->254|PF00575|1e-09|46.5|70/74|S1| RP:PFM:REP 270->340|PF00575|1e-10|45.1|71/74|S1| HM:PFM:NREP 4 HM:PFM:REP 13->83|PF00575|1.7e-18|47.1|70/74|S1| HM:PFM:REP 99->167|PF00575|2.1e-17|34.8|69/74|S1| HM:PFM:REP 185->256|PF00575|2e-29|50.0|72/74|S1| HM:PFM:REP 270->342|PF00575|1.1e-26|43.8|73/74|S1| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF00575|IPR003029| GO:PFM GO:0003723|"GO:RNA binding"|PF00575|IPR003029| RP:SCP:NREP 3 RP:SCP:REP 14->56|2id0A1|2e-05|11.6|43/87|b.40.4.5| RP:SCP:REP 168->280|1wi5A|2e-16|17.7|113/119|b.40.4.5| RP:SCP:REP 269->343|1sroA|1e-19|50.0|74/76|b.40.4.5| HM:SCP:REP 14->110|1wi5A_|1.7e-19|41.2|97/0|b.40.4.5|1/4|Nucleic acid-binding proteins| HM:SCP:REP 88->168|1q46A2|7.3e-17|30.9|81/0|b.40.4.5|2/4|Nucleic acid-binding proteins| HM:SCP:REP 185->269|1go3E1|1.4e-29|52.9|85/0|b.40.4.5|3/4|Nucleic acid-binding proteins| HM:SCP:REP 251->348|1wi5A_|5.4e-30|45.4|97/0|b.40.4.5|4/4|Nucleic acid-binding proteins| OP:NHOMO 2196 OP:NHOMOORG 1013 OP:PATTERN -----------------------11-----1--1-11-11112------------------------- 3342121111112211111-111111111111111121111122111111112111111111111112121122211112212212213332232221111111132312222222222222222111111111115554411-41223333322331121212221333321212222212213222112243333333334333333434434334424434444445413144444444444444454333121221321222114434321-1112222222222111111111223333333333333222333222226435444444454532555333354343233233422343124432122223222211111222112111211211111111111-321221212111111111211121113312122222223222222221111123111222222112211111111111-1111112222222222222222233332233333332223333322333333333332332223212222222222322223323431432342231444333444333344221111111111111111111122121223233332333322222323222222332232-2333122222233333333333333333-333333333333333333333333333333322322233333333333333313333333333332133222222222223332222212332322233333333222333333222222222312211111111123332333333333322333333333333113222333311111111212-------------------------1211111112111 ------------12111--111111111111111111------1111111111111111111--1112-1111111211211111111--2-11-111111---1---3---1-222---111-22---12111-----1--132-1-1--------------1--------11-1222Z55213A466-67124---4 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 343 STR:RPRED 89.8 SQ:SECSTR ####ccccccccccTTcccEEEEEEEETTEEEEEETTTTEEEEEcGGGcccHHHHcHHTccccEEEcEEEEEETTTTEEEEEcccccTTHHHHHHHHHHHHHHHHH#################HHHHTcTTccHHHHHHHHHHHHHHcccccGGGGGGcTTccHHHHHHccccHGGGEEcTTcccGGGGccccGGGHHHHHHHHHHHTccHHTTcHHHHHHccGGGTccccccHHHHHHHHHHHHcTTccccccccTTTTcccccccTTccTTcccccEEEEEETTEEEEEcccccEEEEETTTccccccccHHHHccTTccccccEEEEETTTTEEEEcccccccHTcHHHTcccTTcccccc################## DISOP:02AL 1-2, 342-372| PSIPRED ccHHHHHHHHHHcccccEEEEEEEEEEccEEEEEEccccccccEEHHHHccccccccHHHcccccEEEEEEEEEcccEEEEEEEHHHHHHHHHHHHHHHHccEEEEEEHHHHHccccEEccccccHHHHHHcccHHccccccccccEEEEEEEEEEccccEEEEEccHHHHHHHHHHHHHHHHccccccEEEEEEEEEEccEEEEEEccEEEEEEHHHcccHHHcccHHEEEcccEEEEEEEEEEcccccEEHHHHHccccccHHccccccccEEEEEEEEEEEEcEEEEEEcccccEEEEcccccccccccHHHHEEcccEEEEEEEEEcHHccEEEEEEEcccccccHHHHHHHHHHHcHHHcccccHHHHHHHHHHHcc //