[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ypjA
DDBJ      :ypjA         putative integral inner membrane protein
Swiss-Prot:YPJA_BACSU   RecName: Full=Uncharacterized protein ypjA;

Homologs  Archaea  8/68 : Bacteria  69/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:185 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   13->173 PF07187 * DUF1405 2e-41 59.0 %
:HMM:PFM   13->175 PF07187 * DUF1405 1.7e-62 46.6 163/164  
:BLT:SWISS 1->185 YPJA_BACSU 4e-99 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14169.1 GT:GENE ypjA GT:PRODUCT putative integral inner membrane protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2362407..2362964) GB:FROM 2362407 GB:TO 2362964 GB:DIRECTION - GB:GENE ypjA GB:PRODUCT putative integral inner membrane protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pm: putative membrane component GB:PROTEIN_ID CAB14169.1 GB:DB_XREF GOA:P54392 InterPro:IPR009845 SubtiList:BG11499 UniProtKB/Swiss-Prot:P54392 GB:GENE:GENE ypjA LENGTH 185 SQ:AASEQ MLILVLAINFLGTVYGYYWYLPQLLETPARFLIFVPDSPTATFFFLFVLLAFLMKRNAPLLEALALVTLVKYGLWAVAMNFLVLAVTGDLPWEGYMLIASHFAMAVQGVLYSPYFRFSFWHLAIAAVWTLHNDVIDYLFDMMPQYSMLSDYMTEIGYGTFWLSIFSIALAYFLVVSKKQTKLELM GT:EXON 1|1-185:0| SW:ID YPJA_BACSU SW:DE RecName: Full=Uncharacterized protein ypjA; SW:GN Name=ypjA; OrderedLocusNames=BSU22530; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->185|YPJA_BACSU|4e-99|100.0|185/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 5 TM:REGION 1->23| TM:REGION 29->51| TM:REGION 61->83| TM:REGION 106->128| TM:REGION 155->176| SEG 43->53|ffflfvllafl| RP:PFM:NREP 1 RP:PFM:REP 13->173|PF07187|2e-41|59.0|161/164|DUF1405| HM:PFM:NREP 1 HM:PFM:REP 13->175|PF07187|1.7e-62|46.6|163/164|DUF1405| OP:NHOMO 78 OP:NHOMOORG 77 OP:PATTERN ------------------------11111111------------------------------------ ----------------------------------------------------------------------------------------------------------------------------------------111-----------------------------------------------------1111111111111111111111111111111111111111111111111111111111111--------------------------------------------------------------------------------------------------1--11----1---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 185-186| PSIPRED cHHHHHHHHHHHHHHHHHHcccccccccHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //