[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ypjB
DDBJ      :ypjB         spore formation membrane associated protein
Swiss-Prot:YPJB_BACSU   RecName: Full=Uncharacterized protein ypjB;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.128.1
:264 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  51->104 2df4B2  d.128.1.5 * 9e-04 32.6 %
:RPS:PFM   27->260 PF09577 * Spore_YpjB 4e-45 43.0 %
:HMM:PFM   27->260 PF09577 * Spore_YpjB 1.3e-107 60.3 232/232  
:BLT:SWISS 1->264 YPJB_BACSU e-150 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14168.1 GT:GENE ypjB GT:PRODUCT spore formation membrane associated protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2361544..2362338) GB:FROM 2361544 GB:TO 2362338 GB:DIRECTION - GB:GENE ypjB GB:PRODUCT spore formation membrane associated protein GB:FUNCTION 16.13: Shape 16.5: Explore GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12662922; Product type m: membrane component GB:PROTEIN_ID CAB14168.1 GB:DB_XREF GOA:P54393 InterPro:IPR014231 SubtiList:BG11500 UniProtKB/Swiss-Prot:P54393 GB:GENE:GENE ypjB LENGTH 264 SQ:AASEQ MKRKLTICLLIALIFYNGNAKAAERGSLEELNDLSDTVFQMTRQAKYEEALQVLEYFEKTLKSAEKKQQDPMLTGAQIRQITLGYNDMVRSLKQADTSDTQKLRAAAQFRMLMDAVDNRSDPLWGSLEKPIMEAFTELKRDVQKNGSTSFHEKWNEFISLYDLIYPSLTIDVSEDQLETVGKHIDVIEQEEFQQMTESTKLERLSLLQHDLKNVFDRVEEDDADPSLLWVIITTGSIIITALTYVGYRKYKAEKNKLKKRDYPK GT:EXON 1|1-264:0| SW:ID YPJB_BACSU SW:DE RecName: Full=Uncharacterized protein ypjB;Flags: Precursor; SW:GN Name=ypjB; OrderedLocusNames=BSU22520; SW:KW Complete proteome; Membrane; Signal; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->264|YPJB_BACSU|e-150|100.0|264/264| GO:SWS:NREP 2 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 2 TM:REGION 5->27| TM:REGION 224->246| RP:PFM:NREP 1 RP:PFM:REP 27->260|PF09577|4e-45|43.0|230/233|Spore_YpjB| HM:PFM:NREP 1 HM:PFM:REP 27->260|PF09577|1.3e-107|60.3|232/232|Spore_YpjB| RP:SCP:NREP 1 RP:SCP:REP 51->104|2df4B2|9e-04|32.6|46/292|d.128.1.5| OP:NHOMO 29 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 143-147, 193-203, 252-264| PSIPRED cHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccEEccEEEEEccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //