Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yppG
DDBJ      :yppG         conserved hypothetical protein; methionine-glutamine-rich protein
Swiss-Prot:YPPG_BACSU   RecName: Full=Uncharacterized protein yppG;

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:HMM:PFM   93->119 PF10548 * P22_AR_C 0.001 22.2 27/74  
:BLT:SWISS 1->125 YPPG_BACSU 1e-74 100.0 %
:REPEAT 2|17->29|37->52

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14142.1 GT:GENE yppG GT:PRODUCT conserved hypothetical protein; methionine-glutamine-rich protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2338017..2338394) GB:FROM 2338017 GB:TO 2338394 GB:DIRECTION - GB:GENE yppG GB:PRODUCT conserved hypothetical protein; methionine-glutamine-rich protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14142.1 GB:DB_XREF SubtiList:BG11448 UniProtKB/Swiss-Prot:P50835 GB:GENE:GENE yppG LENGTH 125 SQ:AASEQ MNGSSRSYPRQMGYYYPQHMQGYYQQAAPGYLEQQLPQQHYGQQDYYQPYAPIQPMPMQPPVFSNPYPIPRPNQQQPSQFQSIMSQFKKANGQFDFNKMMDTTGQVMSAMNQVGSLIKGFTSFFK GT:EXON 1|1-125:0| SW:ID YPPG_BACSU SW:DE RecName: Full=Uncharacterized protein yppG; SW:GN Name=yppG; OrderedLocusNames=BSU22250; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->125|YPPG_BACSU|1e-74|100.0|125/100| NREPEAT 1 REPEAT 2|17->29|37->52| HM:PFM:NREP 1 HM:PFM:REP 93->119|PF10548|0.001|22.2|27/74|P22_AR_C| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1--------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED ccccccccHHHHcccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //