[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ypqA
DDBJ      :ypqA         hypothetical protein
Swiss-Prot:YPQA_BACSU   RecName: Full=Uncharacterized protein ypqA;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.15.1
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   53->138 2bolA PDBj 4e-04 14.1 %
:HMM:SCOP  41->139 1shsA_ b.15.1.1 * 1.2e-05 19.4 %
:RPS:PFM   21->78 PF08332 * CaMKII_AD 7e-04 43.1 %
:HMM:PFM   9->46 PF09340 * NuA4 3e-05 39.5 38/80  
:HMM:PFM   35->119 PF04991 * LicD 2.9e-05 17.1 70/191  
:BLT:SWISS 1->139 YPQA_BACSU 3e-78 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14141.1 GT:GENE ypqA GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2337577..2337996 GB:FROM 2337577 GB:TO 2337996 GB:DIRECTION + GB:GENE ypqA GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB14141.1 GB:DB_XREF SubtiList:BG11449 UniProtKB/Swiss-Prot:P50836 GB:GENE:GENE ypqA LENGTH 139 SQ:AASEQ MEFHDDKKNELQKKEEIITEAIDTLFQSSAFGNLINGFQNLINSSLKDVQTTIHVRERDTGLYIDITIPATFRDGEIVVDVKSRYLHVTLQEKQKHQNEATFTSMTRTVQLPYEVRQEDMETSWNEQTMTLFFPKNKHE GT:EXON 1|1-139:0| SW:ID YPQA_BACSU SW:DE RecName: Full=Uncharacterized protein ypqA;Flags: Precursor; SW:GN Name=ypqA; OrderedLocusNames=BSU22240; SW:KW Complete proteome; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->139|YPQA_BACSU|3e-78|100.0|139/139| RP:PDB:NREP 1 RP:PDB:REP 53->138|2bolA|4e-04|14.1|85/301| RP:PFM:NREP 1 RP:PFM:REP 21->78|PF08332|7e-04|43.1|58/127|CaMKII_AD| HM:PFM:NREP 2 HM:PFM:REP 9->46|PF09340|3e-05|39.5|38/80|NuA4| HM:PFM:REP 35->119|PF04991|2.9e-05|17.1|70/191|LicD| GO:PFM:NREP 3 GO:PFM GO:0004683|"GO:calmodulin-dependent protein kinase activity"|PF08332|IPR013543| GO:PFM GO:0005516|"GO:calmodulin binding"|PF08332|IPR013543| GO:PFM GO:0006468|"GO:protein amino acid phosphorylation"|PF08332|IPR013543| HM:SCP:REP 41->139|1shsA_|1.2e-05|19.4|98/115|b.15.1.1|1/1|HSP20-like chaperones| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 62.6 SQ:SECSTR ##################################################cEEEcTTccEEEEEEEEcTT#ccTTTEEEEEETTEEEEEEcccccTTcccccccEEEEEEccTTccGGGcEEEEccccEEEEEEEccc# DISOP:02AL 1-12, 91-104, 135-139| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccEEEEEEccccEEEEEEccccccccEEEEEEEccEEEEEHHHHHHcccccEEcEEEEEEEccEEEcccccccEEcccEEEEEEcccccc //