[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yprB
DDBJ      :yprB         putative nucleic acid binding enzyme
Swiss-Prot:YPRB_BACSU   RecName: Full=Uncharacterized protein yprB;

Homologs  Archaea  8/68 : Bacteria  38/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.118.8c.55.3
:413 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   98->273 1d5aA PDBj 5e-11 22.9 %
:RPS:SCOP  113->280 1s5jA1  c.55.3.5 * 2e-11 19.2 %
:RPS:SCOP  291->374 1w3bA  a.118.8.1 * 5e-04 16.0 %
:HMM:SCOP  103->298 1t7pA1 c.55.3.5 * 3.4e-29 27.1 %
:HMM:SCOP  283->387 1iygA_ a.118.8.1 * 1.4e-06 22.3 %
:HMM:PFM   149->183 PF03104 * DNA_pol_B_exo 3.8e-06 25.7 35/317  
:BLT:SWISS 1->413 YPRB_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14138.1 GT:GENE yprB GT:PRODUCT putative nucleic acid binding enzyme GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2333324..2334565) GB:FROM 2333324 GB:TO 2334565 GB:DIRECTION - GB:GENE yprB GB:PRODUCT putative nucleic acid binding enzyme GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB14138.1 GB:DB_XREF GOA:P50837 SubtiList:BG11452 UniProtKB/Swiss-Prot:P50837 GB:GENE:GENE yprB LENGTH 413 SQ:AASEQ MSLKGKLQRMKKHMALDEGEQKIEAGKQENHFDDIPFLEEWEAFGMKPFIFEDEYCLIREVEYPLSHRHGLYSFSELEEVITLWNQSGLSHTLSAKGYNKNNLFFFDTETTGLGGGAGNTIFLLGHARVYEDRVTVKQHLLPKPGNEVALYQSFLSEVDITSLVTYNGKAFDWPQVKTRHTLIRDRLPKLPEFGHFDLLHGARRLWKHKMDRVSLGTVEKEELGIRRLEDTPGYLAPMLYFHFIKAQEPDLLKGVLHHNEMDVLSLISLYIHMSKKILSESHAPKEHSEAYAMAKWFMAHKETDQAIKQLERLIEKSFEDQDSARLDLSLLYKKQNRLEEAVPLWEKLSRSQNQKCRYAAVIELAKYFEHKKKEFGKALQVAEQSLSDAACLSEKETEKLHVRIARLKRKYSS GT:EXON 1|1-413:0| SW:ID YPRB_BACSU SW:DE RecName: Full=Uncharacterized protein yprB; SW:GN Name=yprB; OrderedLocusNames=BSU22210; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->413|YPRB_BACSU|0.0|100.0|413/413| RP:PDB:NREP 1 RP:PDB:REP 98->273|1d5aA|5e-11|22.9|166/733| HM:PFM:NREP 1 HM:PFM:REP 149->183|PF03104|3.8e-06|25.7|35/317|DNA_pol_B_exo| RP:SCP:NREP 2 RP:SCP:REP 113->280|1s5jA1|2e-11|19.2|167/408|c.55.3.5| RP:SCP:REP 291->374|1w3bA|5e-04|16.0|81/388|a.118.8.1| HM:SCP:REP 103->298|1t7pA1|3.4e-29|27.1|188/0|c.55.3.5|1/1|Ribonuclease H-like| HM:SCP:REP 283->387|1iygA_|1.4e-06|22.3|103/133|a.118.8.1|1/1|TPR-like| OP:NHOMO 48 OP:NHOMOORG 47 OP:PATTERN --------------------------------1-1---1----11-11------------1------- --1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------111111---1111-11------11---------------------------------------------------------------------------------------------1-------------111--------1----------1-------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 218 STR:RPRED 52.8 SQ:SECSTR ###########################################################################################EEEHHHcccccEEEEEEEcccccccccccccEEEEEEETTEEEEEEccccccTTcHHHHHHHHHHHHcccEEEEccTTTTHHHHHHHHHHTTTccccEcTTcEEEEHHHHHHHHTHcccccccHHHHHHHHcccccHccccccHHHHHHHHHHGGHcGGGGTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcTTTccTTccGGGccHHHHHHH######################################################################################################## DISOP:02AL 1-34, 281-284, 388-398, 408-413| PSIPRED cccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHcccEEEEcccEEEEEEEEcccccccccccHHHHHHHHHHHcccccccccccccccHHHEEEEEHHccccccccccEEEEEEEEEEcccEEEEccEEcccHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //