[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yptA
DDBJ      :yptA         hypothetical protein
Swiss-Prot:YPTA_BACSU   RecName: Full=Uncharacterized protein yptA;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->63 YPTA_BACSU 2e-32 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14133.1 GT:GENE yptA GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2329515..2329706) GB:FROM 2329515 GB:TO 2329706 GB:DIRECTION - GB:GENE yptA GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB14133.1 GB:DB_XREF SubtiList:BG11456 UniProtKB/Swiss-Prot:P50841 GB:GENE:GENE yptA LENGTH 63 SQ:AASEQ MLNSEHFNLIQRALDATANELKELGTDSSPSVISHAQTDLEKAVEHIYSTDHPFLSSHVINRK GT:EXON 1|1-63:0| SW:ID YPTA_BACSU SW:DE RecName: Full=Uncharacterized protein yptA;Flags: Precursor; SW:GN Name=yptA; OrderedLocusNames=BSU22160; SW:KW Complete proteome; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->63|YPTA_BACSU|2e-32|100.0|63/63| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccc //