[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ypwA
DDBJ      :ypwA         metal-dependent carboxypeptidase
Swiss-Prot:YPWA_BACSU   RecName: Full=Putative metalloprotease ypwA;         EC=3.4.24.-;

Homologs  Archaea  38/68 : Bacteria  239/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
d.92.1
:501 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->489 3hq2B PDBj 0.0 100.0 %
:RPS:PDB   5->483 3dwcA PDBj 6e-61 34.7 %
:RPS:SCOP  1->489 1k9xA  d.92.1.5 * 1e-67 36.3 %
:HMM:SCOP  4->498 1k9xA_ d.92.1.5 * 1.1e-115 30.6 %
:RPS:PFM   8->489 PF02074 * Peptidase_M32 e-147 51.8 %
:HMM:PFM   1->495 PF02074 * Peptidase_M32 6.7e-273 62.3 494/494  
:BLT:SWISS 1->489 YPWA_BACSU 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14125.1 GT:GENE ypwA GT:PRODUCT metal-dependent carboxypeptidase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2320355..2321860) GB:FROM 2320355 GB:TO 2321860 GB:DIRECTION - GB:GENE ypwA GB:PRODUCT metal-dependent carboxypeptidase GB:FUNCTION 16.11: Scavenge (Catabolism) 16.6: Maintain GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 7765282; Product type e: enzyme GB:PROTEIN_ID CAB14125.1 GB:DB_XREF GOA:P50848 InterPro:IPR001333 PDB:3HQ2 SubtiList:BG11458 UniProtKB/Swiss-Prot:P50848 GB:GENE:GENE ypwA LENGTH 501 SQ:AASEQ MEIHTYEKEFFDLLKRISHYSEAVALMHWDSRTGAPKNGSEDRAESIGQLSTDIFNIQTSDRMKELIDVLYERFDDLSEDTKKAVELAKKEYEENKKIPEAEYKEYVILCSKAETAWEEAKGKSDFSLFSPYLEQLIEFNKRFITYWGYQEHPYDALLDLFEPGVTVKVLDQLFAELKEAIIPLVKQVTASGNKPDTSFITKAFPKEKQKELSLYFLQELGYDFDGGRLDETVHPFATTLNRGDVRVTTRYDEKDFRTAIFGTIHECGHAIYEQNIDEALSGTNLSDGASMGIHESQSLFYENFIGRNKHFWTPYYKKIQEASPVQFKDISLDDFVRAINESKPSFIRVEADELTYPLHIIIRYEIEKAIFSNEVSVEDLPSLWNQKYQDYLGITPQTDAEGILQDVHWAGGDFGYFPSYALGYMYAAQLKQKMLEDLPEFDALLERGEFHPIKQWLTEKVHIHGKRKKPLDIIKDATGEELNVRYLIDYLSNKYSNLYLL GT:EXON 1|1-501:0| SW:ID YPWA_BACSU SW:DE RecName: Full=Putative metalloprotease ypwA; EC=3.4.24.-; SW:GN Name=ypwA; OrderedLocusNames=BSU22080; SW:KW 3D-structure; Complete proteome; Hydrolase; Metal-binding;Metalloprotease; Protease; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->489|YPWA_BACSU|0.0|100.0|489/501| GO:SWS:NREP 4 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008237|"GO:metallopeptidase activity"|Metalloprotease| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| SEG 490->500|ylsnkysnlyl| BL:PDB:NREP 1 BL:PDB:REP 4->489|3hq2B|0.0|100.0|486/497| RP:PDB:NREP 1 RP:PDB:REP 5->483|3dwcA|6e-61|34.7|476/500| RP:PFM:NREP 1 RP:PFM:REP 8->489|PF02074|e-147|51.8|481/492|Peptidase_M32| HM:PFM:NREP 1 HM:PFM:REP 1->495|PF02074|6.7e-273|62.3|494/494|Peptidase_M32| GO:PFM:NREP 2 GO:PFM GO:0004181|"GO:metallocarboxypeptidase activity"|PF02074|IPR001333| GO:PFM GO:0006508|"GO:proteolysis"|PF02074|IPR001333| RP:SCP:NREP 1 RP:SCP:REP 1->489|1k9xA|1e-67|36.3|487/497|d.92.1.5| HM:SCP:REP 4->498|1k9xA_|1.1e-115|30.6|490/0|d.92.1.5|1/1|Metalloproteases ("zincins"), catalytic domain| OP:NHOMO 321 OP:NHOMOORG 296 OP:PATTERN 111-111111111111-111111-11111111----------------------1111111---11-- ------------------------------------------------------------------------------1---1-------------1--------1--1---------------1-----------11111---2------------111111-------111111-11111121111----111111111111111111111111111111-1111111111--------------------1--------------------1-----------------------------------------------------------------------1----------1----1-------11---1---------1------------------------11111111-11-------------11---121111111111111111111-11-11111111111111111112-1-1111111--------------------------------------------1-------1---------1----------1-1----------1----------------1-1--1---------------------------111-------1111112-1111-1111-11-------------11--111------------------------------111--1------------------1---------111111211111---------1111----1--------------------------------------------1-1-1111--11111111111111------------------111111----------11-12---------------------11111------1- --------641-------------------------------------------------------------------------------------------------11-----------------------------------------------------1------------1118111-11-----311----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 486 STR:RPRED 97.0 SQ:SECSTR ###cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccGGGHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHTGGGccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHcTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccccccccHHHHHHHHHHHHHHTTccTTcEEEEEcccccEEEETTTEEEEEEcccTTccHHHHHHHHHHHHHHHHHHTccTTcTTcTTcccccHHHHHHHHHHHHTTTTTcHHHHHHHHHHHHHHHccccTTccHHHHHHHHTcccccccGGGccTTTHHHHHHHHHHHHHHHHHTcccGGGHHHHHHHHHHHHHccccTTcTTTTTcccTTTTTccccTHHHHHHHHHHHHHHHHHHHHHcHHHHHHHTTccHHHHHHHHHHTGGGTTcccHHHHHHHHHccccccHHHHH############ DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHccccHHHHccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHccc //