[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yqbD
DDBJ      :yqbD         putative DNA wielding protein; skin element
Swiss-Prot:YQBD_BACSU   RecName: Full=Uncharacterized protein yqbD;

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:322 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   66->150 1zivA PDBj 7e-04 35.7 %
:HMM:PFM   182->277 PF04412 * DUF521 0.00013 28.7 94/400  
:BLT:SWISS 1->322 YQBD_BACSU e-147 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14556.2 GT:GENE yqbD GT:PRODUCT putative DNA wielding protein; skin element GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2684161..2685129) GB:FROM 2684161 GB:TO 2685129 GB:DIRECTION - GB:GENE yqbD GB:PRODUCT putative DNA wielding protein; skin element GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB14556.2 GB:DB_XREF SubtiList:BG11275 UniProtKB/Swiss-Prot:P45920 GB:GENE:GENE yqbD LENGTH 322 SQ:AASEQ MPRELVNAKITHVSYVDKAANQKQFFIVKSEKQPDFQKEVRILAKEADEQKLVYGIVYEPDTVDAHGDFMTAAEIEKAAHGFLKDARQIDKQHDFQGGVGEVVESYVAPADFEMNGETIKKGSWVLVTKASEEVWEQIKKGEITGYSMAGTAETIEKQEKPVSQEKTDEKGLFNLLKNFFVGKQQQSYEEPVAKAGRKFSASNLQEIKNAHAALGNLLSQVETKEGEEEMTSEEVTKSIQEALEPIKKRLETLEKEEELNKKDKEKEEETEKEGEKLKKAISEAVQPLADRIEAIEKSRGTSKQTEESGSEQVQKSIWSGLF GT:EXON 1|1-322:0| SW:ID YQBD_BACSU SW:DE RecName: Full=Uncharacterized protein yqbD; SW:GN Name=yqbD; OrderedLocusNames=BSU26150; SW:KW Coiled coil; Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->322|YQBD_BACSU|e-147|100.0|322/322| SEG 221->238|vetkegeeemtseevtks| SEG 247->279|kkrletlekeeelnkkdkekeeetekegeklkk| BL:PDB:NREP 1 BL:PDB:REP 66->150|1zivA|7e-04|35.7|84/308| HM:PFM:NREP 1 HM:PFM:REP 182->277|PF04412|0.00013|28.7|94/400|DUF521| OP:NHOMO 13 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1112-1---1----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------- STR:NPRED 84 STR:RPRED 26.1 SQ:SECSTR #################################################################TTccHHHH#HHHHccGGGTTccHHHHHHHHHccccEEEEGGGccTTHHHHHHHHHHTcEEcccccGGGTTcccTTcccTTEEEEE############################################################################################################################################################################ PSIPRED ccccccccEEEHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHcHHccccccccEEEEEEEccccHHcccEEcccccEEEEEEEcHHHHHHHHccEEEEEEEccHHHHHHHHHccccccccccccHHHHHHHHHcccHHHcccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccc //