[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yqbI
DDBJ      :yqbI         conserved hypothetical protein; skin element
Swiss-Prot:YQBI_BACSU   RecName: Full=Uncharacterized protein yqbI;

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:167 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   98->136 PF03454 * MoeA_C 5e-05 25.6 39/73  
:HMM:PFM   132->155 PF08424 * DUF1740 0.00081 33.3 24/236  
:HMM:PFM   27->95 PF04883 * DUF646 0.00083 24.2 66/106  
:BLT:SWISS 1->167 YQBI_BACSU 3e-98 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14551.1 GT:GENE yqbI GT:PRODUCT conserved hypothetical protein; skin element GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2681627..2682130) GB:FROM 2681627 GB:TO 2682130 GB:DIRECTION - GB:GENE yqbI GB:PRODUCT conserved hypothetical protein; skin element GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14551.1 GB:DB_XREF SubtiList:BG11280 UniProtKB/Swiss-Prot:P45925 GB:GENE:GENE yqbI LENGTH 167 SQ:AASEQ MKIRGLDQFIQSLDRASRGGLKRKYEQWLESMGFEFLDIIQDEIIRTKTVDTRRLLNSFQKGDQDNIFSMTEGSLKLDVGTNLDYASYVNDGHFTIDPSKNQDRRWVPGRWKGDRFEYDPAEKNSGMLLKFRWVDGSGFWDNAMAIFQLMFERSLERKLQQWIYEEF GT:EXON 1|1-167:0| SW:ID YQBI_BACSU SW:DE RecName: Full=Uncharacterized protein yqbI; SW:GN Name=yqbI; OrderedLocusNames=BSU26100; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->167|YQBI_BACSU|3e-98|100.0|167/167| HM:PFM:NREP 3 HM:PFM:REP 98->136|PF03454|5e-05|25.6|39/73|MoeA_C| HM:PFM:REP 132->155|PF08424|0.00081|33.3|24/236|DUF1740| HM:PFM:REP 27->95|PF04883|0.00083|24.2|66/106|DUF646| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1112---------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-20| PSIPRED cccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccEEEEEcccEEEEEcccccHHHEEccccEEEcccccccEEEEccEEEccEEEEccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //