[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yqbM
DDBJ      :yqbM         conserved hypothetical protein
Swiss-Prot:YQBM_BACSU   RecName: Full=Uncharacterized protein yqbM;

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
b.106.1
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->147 2gujB PDBj 9e-52 93.9 %
:RPS:SCOP  5->143 2gujA1  b.106.1.3 * 3e-35 81.2 %
:RPS:PFM   1->139 PF09393 * DUF2001 1e-28 50.4 %
:HMM:PFM   1->141 PF09393 * DUF2001 4.1e-59 56.1 139/142  
:BLT:SWISS 1->147 YQBM_BACSU 2e-70 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14547.2 GT:GENE yqbM GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2679142..2679585) GB:FROM 2679142 GB:TO 2679585 GB:DIRECTION - GB:GENE yqbM GB:PRODUCT conserved hypothetical protein GB:FUNCTION 16.5: Explore GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function; PubMedId: 8760915, 8969508 GB:PROTEIN_ID CAB14547.2 GB:DB_XREF InterPro:IPR018989 SubtiList:BG11284 UniProtKB/Swiss-Prot:P45929 GB:GENE:GENE yqbM LENGTH 147 SQ:AASEQ MALKAQNTISGKEGRLFLDGEEMAHIKTFEANVEKNKSEVNIMGRRMTGHKTTGANGTGTATFYKVTSQFVLIMMDYVKKGSDPYFTLQAVLDDASSGRGTERVTLYDVNFDSAKIAGLDVDSEALEEEVPFTFEDFDVPEQLKSTF GT:EXON 1|1-147:0| SW:ID YQBM_BACSU SW:DE RecName: Full=Uncharacterized protein yqbM; SW:GN Name=yqbM; OrderedLocusNames=BSU26060; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->147|YQBM_BACSU|2e-70|100.0|147/147| SEG 48->62|tghkttgangtgtat| BL:PDB:NREP 1 BL:PDB:REP 5->147|2gujB|9e-52|93.9|132/132| RP:PFM:NREP 1 RP:PFM:REP 1->139|PF09393|1e-28|50.4|137/139|DUF2001| HM:PFM:NREP 1 HM:PFM:REP 1->141|PF09393|4.1e-59|56.1|139/142|DUF2001| RP:SCP:NREP 1 RP:SCP:REP 5->143|2gujA1|3e-35|81.2|133/133|b.106.1.3| OP:NHOMO 28 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1112------1---1------1----------------------------2--------------------------------------------------------------1--1-2-11---21-3------21--------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 89.8 SQ:SECSTR ####ccccEEEEEEEEEETTEE#EEEEEEEEEEccccccTTT#HHHHTcccccccEEEEEE#EccccHHHHHH##HHHHTTccccEEEEEEEccTTccccccEEEEEEEcccHHHHHTTc######ccEEEEcccEEEccccccTTc DISOP:02AL 147-148| PSIPRED ccEEEEEEEcccEEEEEEcccEEEEEEEEEEEEEEcHHHHHHHcccccccEEEEEEEEEEEEEEEEcHHHHHHHHHHHHccccEEEEEEEEEccccccccEEEEEEEccEEccEEEEEEEEccccEEEEccccccccccHHHHHccc //