[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yqbR
DDBJ      :yqbR         conserved hypothetical protein; skin element
Swiss-Prot:YQBR_BACSU   RecName: Full=Uncharacterized protein yqbR;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->87 PF10844 * DUF2577 3e-08 41.8 %
:HMM:PFM   3->87 PF10844 * DUF2577 3.6e-30 57.8 83/98  
:BLT:SWISS 1->87 YQBR_BACSU 1e-43 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14541.1 GT:GENE yqbR GT:PRODUCT conserved hypothetical protein; skin element GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2670801..2671064) GB:FROM 2670801 GB:TO 2671064 GB:DIRECTION - GB:GENE yqbR GB:PRODUCT conserved hypothetical protein; skin element GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14541.1 GB:DB_XREF SubtiList:BG11289 UniProtKB/Swiss-Prot:P45933 GB:GENE:GENE yqbR LENGTH 87 SQ:AASEQ MRLSEAIKHLAVRAVDSESPVDILPAEVVSVSPVEIRLNENDKLIIPADLIIVPKRLRAGEEALNTGERVMIVSLKGGQSFFILDKI GT:EXON 1|1-87:0| SW:ID YQBR_BACSU SW:DE RecName: Full=Uncharacterized protein yqbR; SW:GN Name=yqbR; OrderedLocusNames=BSU26000; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->87|YQBR_BACSU|1e-43|100.0|87/87| RP:PFM:NREP 1 RP:PFM:REP 7->87|PF10844|3e-08|41.8|79/103|DUF2577| HM:PFM:NREP 1 HM:PFM:REP 3->87|PF10844|3.6e-30|57.8|83/98|DUF2577| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1112----------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccHHHHHHHHHcccccccccEEEEcccEEEEcEEEEEEccccEEEEcHHHHHHHHHHcccccccccccEEEEEEEccccEEEEEEEc //