[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yqcI
DDBJ      :yqcI         conserved hypothetical protein
Swiss-Prot:YQCI_BACSU   RecName: Full=Uncharacterized protein yqcI;

Homologs  Archaea  6/68 : Bacteria  40/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
:254 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   51->100 3d6nB PDBj 3e-04 30.8 %
:RPS:PDB   124->211 1e5vA PDBj 5e-04 11.0 %
:RPS:PFM   39->241 PF08892 * YqcI_YcgG 5e-45 49.7 %
:HMM:PFM   25->243 PF08892 * YqcI_YcgG 4.2e-91 48.8 215/219  
:BLT:SWISS 1->254 YQCI_BACSU e-156 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14523.2 GT:GENE yqcI GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2658006..2658770) GB:FROM 2658006 GB:TO 2658770 GB:DIRECTION - GB:GENE yqcI GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 8760915, 8969508; Product type h : extrachromosomal origin GB:PROTEIN_ID CAB14523.2 GB:DB_XREF InterPro:IPR014988 SubtiList:BG11300 UniProtKB/Swiss-Prot:P45944 GB:GENE:GENE yqcI LENGTH 254 SQ:AASEQ MTELYAKSDLEKIKETLPGWQLDSFNYLNEKIGDKENKFPCIPGRQAFLSDQLRIAFVGDPRNPETAKELAPLLTRYGTISRETGKYASLTVIFHTPEELLTDYKIEDYESLFWQLLNSLSMEDPADWPDDIPENPDNFQWEYCFNGEPYFVLCATPAHSKRKSRSFPYFMLTFQPRWVFEDLNDTTAFGRNMSKQIRKRLEAYDEVPIHPHLGWYGKKDNLEWKQYFLRDDENQVSQCPFMKMKNLFKKKRSD GT:EXON 1|1-254:0| SW:ID YQCI_BACSU SW:DE RecName: Full=Uncharacterized protein yqcI; SW:GN Name=yqcI; OrderedLocusNames=BSU25820; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->254|YQCI_BACSU|e-156|100.0|254/254| RP:PDB:NREP 2 RP:PDB:REP 51->100|3d6nB|3e-04|30.8|39/291| RP:PDB:REP 124->211|1e5vA|5e-04|11.0|82/766| RP:PFM:NREP 1 RP:PFM:REP 39->241|PF08892|5e-45|49.7|199/217|YqcI_YcgG| HM:PFM:NREP 1 HM:PFM:REP 25->243|PF08892|4.2e-91|48.8|215/219|YqcI_YcgG| OP:NHOMO 70 OP:NHOMOORG 57 OP:PATTERN ------------------------11111-1------------------------------------- -----------------------------------------1---------------------------------------------------------1---1---------------------------------------------------------------------------------1-------1222221121222112----12221---11----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------1----------------1-------------------1-----------------------------------------------------------------------------------------1----------------------------------------1--------------------------------------------------------------------------------------------1--------------------------------1----1111-1--------------------------------------------------------------------------------------------------- -------------1--1----------------111--------------11-1--1----------------------------------11---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 50.0 SQ:SECSTR ##################################################TTcEEEEEcccTTcHHHHHHHHHHHHTT###########cEEEEEccGGG#######################cccccTTccEEcccHHHHHHccTcccccccccccccTTcTTccccEEEEccccccccTTcTTTcGGGGGTccTTccEEEcTTcEEEcH########################################### PSIPRED cEEEEEHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHcccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEcccEEEEEEccccccccccccccccEEEEcHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccccccHHHHHHHHHcccccc //