[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yqeB
DDBJ      :yqeB         conserved hypothetical protein
Swiss-Prot:YQEB_BACSU   RecName: Full=Uncharacterized protein yqeB;

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:240 amino acids
:PSIPRED
:HMM:PFM   6->85 PF09988 * DUF2227 0.0008 16.0 75/174  
:BLT:SWISS 1->240 YQEB_BACSU e-131 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14515.2 GT:GENE yqeB GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2651632..2652354 GB:FROM 2651632 GB:TO 2652354 GB:DIRECTION + GB:GENE yqeB GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14515.2 GB:DB_XREF GOA:P54447 SubtiList:BG11630 UniProtKB/Swiss-Prot:P54447 GB:GENE:GENE yqeB LENGTH 240 SQ:AASEQ MLQNQSHTLIGVTKTAVFFLYAALAIIGFAIGYFIPQIAKWALSLPWIPLEGPLRLITSFQGSTASFITALLGMCAGIWFAHSVIAMLLSVKITDHTVEFIKGKKVQTIHSDDIALVFMDHKRLVLLGTAGYELVREEIDEKPVNVEKAFRQHHYEWATDGDPFKDQFRRWIPDAPDLSQGAHALLKARHKALQDEEKDDIEEFRLELAQLGIVVRDEGTRQYWRKAETYPPKIQLGEGL GT:EXON 1|1-240:0| SW:ID YQEB_BACSU SW:DE RecName: Full=Uncharacterized protein yqeB; SW:GN Name=yqeB; OrderedLocusNames=BSU25740; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->240|YQEB_BACSU|e-131|100.0|240/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 3 TM:REGION 11->33| TM:REGION 68->90| TM:REGION 114->136| SEG 182->193|ahallkarhkal| HM:PFM:NREP 1 HM:PFM:REP 6->85|PF09988|0.0008|16.0|75/174|DUF2227| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------1------1-----1--1-11-1----------------1----------------------------------------------------------------------------------------------------1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccEEEEEEccEEEEEEEccEEEEEEEccEEEEEccccHHHHHHHHHHcHHHHHHHHHHcccccccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccHHHHHHHHHcccccccccccc //