[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yqfW
DDBJ      :yqfW         putative nucleotidase
Swiss-Prot:YQFW_BACSU   RecName: Full=Putative nucleotidase yqfW;         EC=3.1.3.-;

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:193 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->185 3bwvB PDBj 2e-20 18.8 %
:RPS:SCOP  1->185 1mh9A  c.108.1.8 * 1e-18 15.6 %
:HMM:SCOP  2->174 1n8nA_ c.108.1.12 * 2.3e-14 21.0 %
:RPS:PFM   3->179 PF06941 * NT5C 7e-10 30.5 %
:HMM:PFM   44->117 PF03767 * Acid_phosphat_B 2.8e-06 20.3 69/230  
:HMM:PFM   139->185 PF02571 * CbiJ 0.00024 25.5 47/250  
:BLT:SWISS 1->193 YQFW_BACSU e-114 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14439.1 GT:GENE yqfW GT:PRODUCT putative nucleotidase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2590804..2591385 GB:FROM 2590804 GB:TO 2591385 GB:DIRECTION + GB:GENE yqfW GB:PRODUCT putative nucleotidase GB:FUNCTION 16.6: Maintain 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB14439.1 GB:DB_XREF GOA:P54480 InterPro:IPR009206 SubtiList:BG11669 UniProtKB/Swiss-Prot:P54480 GB:GENE:GENE yqfW LENGTH 193 SQ:AASEQ MLRLGIDIDGTITAQDTFVPYLNRSFNLSISLNDMTDYDLTKLLNITQEEFWDWMNQNEAIIYKEALLAQHAKQSLDLLKEEHKLIYITARRTHLTDITYEWFDRQNIHYDHIELVGGHHKVEAVKNHNIDLFFEDHHGNAMMIAKEAGIPVILFNSPYNQLPIDSNIIRVNNWLEAVQWMNNNKHHLIRVNN GT:EXON 1|1-193:0| SW:ID YQFW_BACSU SW:DE RecName: Full=Putative nucleotidase yqfW; EC=3.1.3.-; SW:GN Name=yqfW; OrderedLocusNames=BSU25090; SW:KW Complete proteome; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->193|YQFW_BACSU|e-114|100.0|193/193| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| RP:PDB:NREP 1 RP:PDB:REP 2->185|3bwvB|2e-20|18.8|160/162| RP:PFM:NREP 1 RP:PFM:REP 3->179|PF06941|7e-10|30.5|167/184|NT5C| HM:PFM:NREP 2 HM:PFM:REP 44->117|PF03767|2.8e-06|20.3|69/230|Acid_phosphat_B| HM:PFM:REP 139->185|PF02571|0.00024|25.5|47/250|CbiJ| GO:PFM:NREP 1 GO:PFM GO:0016791|"GO:phosphatase activity"|PF06941|IPR010708| RP:SCP:NREP 1 RP:SCP:REP 1->185|1mh9A|1e-18|15.6|180/194|c.108.1.8| HM:SCP:REP 2->174|1n8nA_|2.3e-14|21.0|157/0|c.108.1.12|1/1|HAD-like| OP:NHOMO 38 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------111111---1111-11------1-1------------------------------------------------------------------------------------------11111111111-1--111--------------1111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 95.3 SQ:SECSTR #cEEEEETcTTTcEEccHHHHHHHHHHHHHHHHHHTTccccGGGTTccccHHHHHHcTHcTTTTTccccTTHHHHHHHHTTTcEEEEEEccccGGGHHHHHHHHHHcTTccGGGEEEcccGGGcTTcccccEEEEccHHHHTTccccEEEEEEEEccGGGTTccccccEEEccHHHHHHHHHHHc######## DISOP:02AL 192-193| PSIPRED cEEEEEEEcHHHccHHHHHHHHHHHHcccccHHHcEEEEEEEcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccccccEEEEccccHHHHHHHcccEEEEEccHHHHHHHHHHcccEEEEEEccccccccccccEEEccHHHHHHHHHccccEEEEEcc //