[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yqhT
DDBJ      :yqhT         putative aminopeptidase
Swiss-Prot:YQHT_BACSU   RecName: Full=Uncharacterized peptidase yqhT;         EC=3.4.-.-;

Homologs  Archaea  67/68 : Bacteria  900/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
c.55.2d.127.1
:353 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->353 2zsgB PDBj 2e-73 40.3 %
:RPS:PDB   2->353 1chmA PDBj 4e-74 23.0 %
:RPS:SCOP  1->125 1chmA1  c.55.2.1 * 3e-25 22.4 %
:RPS:SCOP  144->348 1pv9A2  d.127.1.1 * 1e-57 51.7 %
:HMM:SCOP  6->127 1pv9A1 c.55.2.1 * 4.3e-38 49.6 %
:HMM:SCOP  78->349 1b6aA2 d.127.1.1 * 2.9e-79 39.8 %
:RPS:PFM   2->125 PF01321 * Creatinase_N 1e-21 41.9 %
:RPS:PFM   146->336 PF00557 * Peptidase_M24 2e-44 43.2 %
:HMM:PFM   136->337 PF00557 * Peptidase_M24 6.7e-66 42.7 199/203  
:HMM:PFM   2->127 PF01321 * Creatinase_N 1.3e-33 41.1 124/131  
:BLT:SWISS 1->353 YQHT_BACSU 0.0 100.0 %
:PROS 283->295|PS00491|PROLINE_PEPTIDASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14377.1 GT:GENE yqhT GT:PRODUCT putative aminopeptidase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2538697..2539758) GB:FROM 2538697 GB:TO 2539758 GB:DIRECTION - GB:GENE yqhT GB:PRODUCT putative aminopeptidase GB:FUNCTION 16.11: Scavenge (Catabolism) 16.6: Maintain GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB14377.1 GB:DB_XREF GOA:P54518 HSSP:1A16 InterPro:IPR001131 SubtiList:BG11708 UniProtKB/Swiss-Prot:P54518 GB:GENE:GENE yqhT LENGTH 353 SQ:AASEQ MKLEKLRNLFGQLGIDGMLITSNTNVRYMTGFTGSAGLAVISGDKAAFITDFRYTEQAKVQVKGFEIIEHGGSLIQTTADTVESFGIKRLGFEQNSMTYGTYASYSAVISDAELVPVAESVEKLRLIKSSEEIKILEEAAKIADDAFRHILTFMKPGISEIAVANELEFYMRSQGADSSSFDMIVASGLRSSLPHGVASDKLIESGDLVTLDFGAYYKGYCSDITRTVAVGQPSDQLKEIYQVVFDAQALGVAHIKPGMTGKEADALTRDHIAAKGYGDYFGHSTGHGLGMEVHESPGLSVRSSAILEPGMVVTVEPGIYIPETGGVRIEDDIVITENGNRTITHSPKELIIL GT:EXON 1|1-353:0| SW:ID YQHT_BACSU SW:DE RecName: Full=Uncharacterized peptidase yqhT; EC=3.4.-.-; SW:GN Name=yqhT; OrderedLocusNames=BSU24460; SW:KW Complete proteome; Hydrolase; Manganese; Metal-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->353|YQHT_BACSU|0.0|100.0|353/353| GO:SWS:NREP 2 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 283->295|PS00491|PROLINE_PEPTIDASE|PDOC00417| SEG 126->143|liksseeikileeaakia| BL:PDB:NREP 1 BL:PDB:REP 13->353|2zsgB|2e-73|40.3|340/352| RP:PDB:NREP 1 RP:PDB:REP 2->353|1chmA|4e-74|23.0|352/401| RP:PFM:NREP 2 RP:PFM:REP 2->125|PF01321|1e-21|41.9|124/130|Creatinase_N| RP:PFM:REP 146->336|PF00557|2e-44|43.2|190/203|Peptidase_M24| HM:PFM:NREP 2 HM:PFM:REP 136->337|PF00557|6.7e-66|42.7|199/203|Peptidase_M24| HM:PFM:REP 2->127|PF01321|1.3e-33|41.1|124/131|Creatinase_N| GO:PFM:NREP 2 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01321|IPR000587| GO:PFM GO:0009987|"GO:cellular process"|PF00557|IPR000994| RP:SCP:NREP 2 RP:SCP:REP 1->125|1chmA1|3e-25|22.4|125/155|c.55.2.1| RP:SCP:REP 144->348|1pv9A2|1e-57|51.7|205/221|d.127.1.1| HM:SCP:REP 6->127|1pv9A1|4.3e-38|49.6|115/0|c.55.2.1|1/1|Creatinase/prolidase N-terminal domain| HM:SCP:REP 78->349|1b6aA2|2.9e-79|39.8|269/296|d.127.1.1|1/1|Creatinase/aminopeptidase| OP:NHOMO 3644 OP:NHOMOORG 1163 OP:PATTERN 11111122222222221222222112221141111111111113422111222133332331112-11 2573533333334234322-24223722222345552455211212332324322422225251522364311111112243321222544514332--2232323233212222222222222333223222322444442224324534433322221222342344442222222222223323322333377777777477777754334477845656343333337523333333333333333333322323333233333442322332221122122222222222222222222222222222222222222214326666768746447335555323124343376451322432222322422122321111223332222223222332332337-112112126E2154423243435442232268343345422222222122322322211222222222222122222222222232353133333444444344444457555555556233312222232222332422212322622222222222223343342432332213444342543444412432212222222221222222222122222235135453543333444444343433451-131121-----53421534444444444-44444444444444444444541143434333333333333333444333321334344333444--12222222222213642222222111-2222433352211122224234334344512342222222223111111111222113354544444333311142222222222222222212212-22222112222221121111232222222231 2211566-84324434441533335254444442233433133444554533641131323334533434443534443445553433-67646575454433A991335E695469323345485172Ai61866341273465454246118365544754667-67AB53744342q5454567982763456677 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 353 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHTTccEEEEccHHHHHHHHcccccccEEEEccccEEEEEEGGGTTHHHHHccccEEEEEcTTcTTHHHHHHHHHcccEEEEcTTTccHHHHHHHHHHcTTcEEEEcHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHHHHHHHHHHHHcccEEEEEEGGGGGcTTcccccccccTTcEEEEEEEcEETTEEccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHHHHHHHHTcGGGcccccccccccEETTEEcccTTccccccTTcEEEEccEEEEcTTEEEEccEEEEEETTEEEEcccccccHHHH DISOP:02AL 353-354| PSIPRED ccHHHHHHHHHHccccEEEEccccHHHHHcccccccEEEEEccccEEEEEEccccHHHHHHcccccEEEcccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHcccccEEEcHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccEEEEcccccccccccccccccccccEEEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccEEEEEEcccccccccccccccEEccccEEEEcccEEEccccEEEEEEEEEEcccccEEccccccEEEEc //