[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yqhY
DDBJ      :yqhY         conserved hypothetical protein
Swiss-Prot:YQHY_BACSU   RecName: Full=Uncharacterized protein yqhY;

Homologs  Archaea  0/68 : Bacteria  202/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:135 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   17->120 PF03780 * DUF322 3e-21 51.0 %
:HMM:PFM   16->121 PF03780 * DUF322 3e-39 46.2 106/108  
:BLT:SWISS 1->135 YQHY_BACSU 4e-73 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14364.2 GT:GENE yqhY GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2529926..2530333) GB:FROM 2529926 GB:TO 2530333 GB:DIRECTION - GB:GENE yqhY GB:PRODUCT conserved hypothetical protein GB:FUNCTION 16.13: Shape 16.6: Maintain GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function; PubMedId: 16014871, 17114254 GB:PROTEIN_ID CAB14364.2 GB:DB_XREF InterPro:IPR005531 SubtiList:BG11709 UniProtKB/Swiss-Prot:P54519 GB:GENE:GENE yqhY LENGTH 135 SQ:AASEQ MKDNSLLKMDHEDTHLGKVEIAPEVIEVIAGIAASEVDGVAEMRGNFATGVVERFGKVNHGKGVKVDLADDGITIDVYCVVTFGVSIPKVAASVQENIRQTLLNMTSLSINEINIHIVGIQFDTKAQEVQIDEEM GT:EXON 1|1-135:0| SW:ID YQHY_BACSU SW:DE RecName: Full=Uncharacterized protein yqhY; SW:GN Name=yqhY; OrderedLocusNames=BSU24330; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->135|YQHY_BACSU|4e-73|100.0|135/135| RP:PFM:NREP 1 RP:PFM:REP 17->120|PF03780|3e-21|51.0|104/107|DUF322| HM:PFM:NREP 1 HM:PFM:REP 16->121|PF03780|3e-39|46.2|106/108|DUF322| OP:NHOMO 379 OP:NHOMOORG 202 OP:PATTERN -------------------------------------------------------------------- ------------1-1------------------1111211--1-11---1--------------1-1111----------1--------------------------------------------------------------------------------------------------------1--21-31222222222222222222222222222222322222223313333333333333333333212122121112222223222212222222222222222222222222222222222222222222222223321222222212111111111211-12222122112122112222-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 134-136| PSIPRED cccccccHHHHHHccccEEEEcHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHccccccccEEEEEEccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEEEcccHHHccHHHcc //