[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yqjY
DDBJ      :yqjY         putative acetyltransferase
Swiss-Prot:YQJY_BACSU   RecName: Full=Uncharacterized protein yqjY;

Homologs  Archaea  2/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:156 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->156 1mk4A PDBj 3e-91 100.0 %
:RPS:PDB   3->127 3bj8C PDBj 6e-15 18.4 %
:RPS:SCOP  1->156 1mk4A  d.108.1.1 * 8e-22 100.0 %
:HMM:SCOP  1->156 1mk4A_ d.108.1.1 * 1.8e-23 22.4 %
:RPS:PFM   54->124 PF00583 * Acetyltransf_1 5e-06 31.0 %
:HMM:PFM   57->124 PF00583 * Acetyltransf_1 1.7e-17 32.4 68/83  
:BLT:SWISS 1->156 YQJY_BACSU 8e-91 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14301.1 GT:GENE yqjY GT:PRODUCT putative acetyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2463571..2464041) GB:FROM 2463571 GB:TO 2464041 GB:DIRECTION - GB:GENE yqjY GB:PRODUCT putative acetyltransferase GB:FUNCTION 16.6: Maintain 16.8: Protect GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 16267290; Product type pe : putative enzyme GB:PROTEIN_ID CAB14301.1 GB:DB_XREF GOA:P54562 InterPro:IPR000182 PDB:1MK4 SubtiList:BG11754 UniProtKB/Swiss-Prot:P54562 GB:GENE:GENE yqjY LENGTH 156 SQ:AASEQ MDIRTITSSDYEMVTSVLNEWWGGRQLKEKLPRLFFEHFQDTSFITSEHNSMTGFLIGFQSQSDPETAYIHFSGVHPDFRKMQIGKQLYDVFIETVKQRGCTRVKCVTSPVNKVSIAYHTKLGFDIEKGTKTVNGISVFANYDGPGQDRVLFVKNI GT:EXON 1|1-156:0| SW:ID YQJY_BACSU SW:DE RecName: Full=Uncharacterized protein yqjY; SW:GN Name=yqjY; OrderedLocusNames=BSU23690; SW:KW 3D-structure; Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->156|YQJY_BACSU|8e-91|100.0|156/156| BL:PDB:NREP 1 BL:PDB:REP 1->156|1mk4A|3e-91|100.0|156/157| RP:PDB:NREP 1 RP:PDB:REP 3->127|3bj8C|6e-15|18.4|125/158| RP:PFM:NREP 1 RP:PFM:REP 54->124|PF00583|5e-06|31.0|71/80|Acetyltransf_1| HM:PFM:NREP 1 HM:PFM:REP 57->124|PF00583|1.7e-17|32.4|68/83|Acetyltransf_1| GO:PFM:NREP 2 GO:PFM GO:0008080|"GO:N-acetyltransferase activity"|PF00583|IPR000182| GO:PFM GO:0008152|"GO:metabolic process"|PF00583|IPR000182| RP:SCP:NREP 1 RP:SCP:REP 1->156|1mk4A|8e-22|100.0|156/157|d.108.1.1| HM:SCP:REP 1->156|1mk4A_|1.8e-23|22.4|156/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 39 OP:NHOMOORG 37 OP:PATTERN ----------------------------------1----------1---------------------- ----1---------1---------------------1----1-2----------------------1-----------------------------------------------------------------------------1------------------------------------------------1111111111111111----111-1-1111--------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------1--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 100.0 SQ:SECSTR cEEEEccGGGHHHHHHHHHHGGGccccHHHHHHHHHccccccEEcccccccEEEEEEEEEETTTEEEEEEEEEEEcGGGTTccHHHHHHHHHHHHHHHHTcccEEcccccccHHHHHHHHTTTccccHHHHTcccEEEETTTTcTTccEEEEEEEc PSIPRED cEEEEccHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccEEEEEEccEEEEEEEEEEEEccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHcccEEEccEEEEccEEEcccccccccEEEEEEEEc //