[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yqkC
DDBJ      :yqkC         conserved hypothetical protein
Swiss-Prot:YQKC_BACSU   RecName: Full=Uncharacterized protein yqkC;

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->79 PF10827 * DUF2552 1e-22 60.8 %
:HMM:PFM   1->79 PF10827 * DUF2552 7.2e-51 81.0 79/79  
:BLT:SWISS 1->79 YQKC_BACSU 5e-44 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14297.1 GT:GENE yqkC GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2461621..2461860) GB:FROM 2461621 GB:TO 2461860 GB:DIRECTION - GB:GENE yqkC GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14297.1 GB:DB_XREF SubtiList:BG11758 UniProtKB/Swiss-Prot:P54566 GB:GENE:GENE yqkC LENGTH 79 SQ:AASEQ MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL GT:EXON 1|1-79:0| SW:ID YQKC_BACSU SW:DE RecName: Full=Uncharacterized protein yqkC; SW:GN Name=yqkC; OrderedLocusNames=BSU23650; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->79|YQKC_BACSU|5e-44|100.0|79/100| RP:PFM:NREP 1 RP:PFM:REP 1->79|PF10827|1e-22|60.8|79/79|DUF2552| HM:PFM:NREP 1 HM:PFM:REP 1->79|PF10827|7.2e-51|81.0|79/79|DUF2552| OP:NHOMO 27 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111--1111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED ccHHHHHHHHHHHccHHHHcccccccEEEEEEEcccccHHHHcEEEEccccEEEccccccHHHHHHHHHHcHHHHHHcc //