[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yqxG
DDBJ      :yqxG         putative phage-related lytic exoenzyme; skin element
Swiss-Prot:YQXG_BACSU   RecName: Full=Uncharacterized protein yqxG;AltName: Full=ORF1;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:297 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   43->95 PF10978 * DUF2785 0.00061 18.9 53/175  
:BLT:SWISS 1->297 YQXG_BACSU e-170 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14533.1 GT:GENE yqxG GT:PRODUCT putative phage-related lytic exoenzyme; skin element GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2665903..2666796) GB:FROM 2665903 GB:TO 2666796 GB:DIRECTION - GB:GENE yqxG GB:PRODUCT putative phage-related lytic exoenzyme; skin element GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB14533.1 GB:DB_XREF SubtiList:BG11069 UniProtKB/Swiss-Prot:P24810 GB:GENE:GENE yqxG LENGTH 297 SQ:AASEQ MASYSFQFSTDATGKPGAAKPYREGNRDFVVPVASISGNSELLTNAVLKATEVYTQYGQDRLGQVLISKVKGHAYSDREGTLFIEESNDMNSWTTISSLVVKANTLGETEWIHLTKRYFRFRYANGNLQQSEFLLYQSLGAGEEDININHTVPITAVAPFSVQLDKSGLTNDGRLKVQTEGLNLSSLDTQSKTMDIVFHDKTETIGEGNPFTVGSFKTLLIEVYGTAETSELKFWGKSLSGTKRALRGQKVDDGTFATSTKGKSEAWSFSITGFKEIVMELTALTNGNFSVRGTAVS GT:EXON 1|1-297:0| SW:ID YQXG_BACSU SW:DE RecName: Full=Uncharacterized protein yqxG;AltName: Full=ORF1; SW:GN Name=yqxG; Synonyms=yqdC; OrderedLocusNames=BSU25920; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->297|YQXG_BACSU|e-170|100.0|297/297| HM:PFM:NREP 1 HM:PFM:REP 43->95|PF10978|0.00061|18.9|53/175|DUF2785| OP:NHOMO 5 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------3---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-2| PSIPRED ccEEEEEcccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccEEEccccEEEEEEcccccEEEEEEEEEEEcccccccEEEEEEEEEEEEEEEcccccccEEEEEEEcccccEEEEEcccccEEEEcccEEEEEccccccccEEEEEEccEEEEccccccEEEEEEEEccccccccccccEEccEEEEEEEEEEcccEEEEEEEEEcccccEEEEccccccccEEEEcccccccEEEEcHHHHHHHHHHHEEEccccEEEEEEEEc //