[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yqzH
DDBJ      :yqzH         hypothetical protein
Swiss-Prot:YQZH_BACSU   RecName: Full=Uncharacterized protein yqzH;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:68 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->59 PF03486 * HI0933_like 0.00018 19.1 47/409  
:BLT:SWISS 1->68 YQZH_BACSU 6e-36 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14304.1 GT:GENE yqzH GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2465966..2466172 GB:FROM 2465966 GB:TO 2466172 GB:DIRECTION + GB:GENE yqzH GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB14304.1 GB:DB_XREF SubtiList:BG13774 UniProtKB/Swiss-Prot:O32014 GB:GENE:GENE yqzH LENGTH 68 SQ:AASEQ MEKFVEKMLGQALRQYGRNVAIDPLSPYEKQSLKAALQERRNEEPDEDLHAHIEDIIYDYVTNQGLFS GT:EXON 1|1-68:0| SW:ID YQZH_BACSU SW:DE RecName: Full=Uncharacterized protein yqzH; SW:GN Name=yqzH; OrderedLocusNames=BSU23720; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->68|YQZH_BACSU|6e-36|100.0|68/68| HM:PFM:NREP 1 HM:PFM:REP 13->59|PF03486|0.00018|19.1|47/409|HI0933_like| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 37-46| PSIPRED cHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccc //