[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yraA
DDBJ      :yraA         general stress protein
Swiss-Prot:YRAA_BACSU   RecName: Full=Putative cysteine protease yraA;         EC=3.2.-.-;

Homologs  Archaea  49/68 : Bacteria  498/915 : Eukaryota  29/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:169 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->168 1oi4B PDBj 1e-50 57.1 %
:RPS:PDB   2->169 2ab0A PDBj 2e-30 20.2 %
:RPS:SCOP  4->169 1g2iA  c.23.16.2 * 1e-49 42.4 %
:HMM:SCOP  1->168 1oi4A_ c.23.16.2 * 1.6e-53 46.4 %
:RPS:PFM   51->154 PF01965 * DJ-1_PfpI 9e-19 44.2 %
:HMM:PFM   31->168 PF01965 * DJ-1_PfpI 5.7e-43 46.4 138/148  
:BLT:SWISS 1->169 YRAA_BACSU 3e-94 100.0 %
:REPEAT 2|16->84|93->162

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14644.2 GT:GENE yraA GT:PRODUCT general stress protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2757492..2758001 GB:FROM 2757492 GB:TO 2758001 GB:DIRECTION + GB:GENE yraA GB:PRODUCT general stress protein GB:FUNCTION 16.8: Protect GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12775685, 17257049, 17933887; Product type f: factor GB:PROTEIN_ID CAB14644.2 GB:DB_XREF GOA:O06006 HSSP:1OI4 InterPro:IPR002818 SubtiList:BG13776 UniProtKB/Swiss-Prot:O06006 GB:GENE:GENE yraA LENGTH 169 SQ:AASEQ MSKKIAVLVTDQFEDIEYTSPVKAYEEAGYSVVAIDLEAGKEVTGKHGEKVKIDKAISDVDASDFDALLIPGGFSPDLLRADDRPGEFAKAFVENKKPVFAICHGPQVLIDTDLLKGKDITGYRSIRKDLINAGANYKDAEVVVSHNIVTSRTPDDLEAFNRESLNLLK GT:EXON 1|1-169:0| SW:ID YRAA_BACSU SW:DE RecName: Full=Putative cysteine protease yraA; EC=3.2.-.-; SW:GN Name=yraA; OrderedLocusNames=BSU27020; SW:KW Complete proteome; Hydrolase; Protease; Stress response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->169|YRAA_BACSU|3e-94|100.0|169/169| GO:SWS:NREP 3 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0006950|"GO:response to stress"|Stress response| NREPEAT 1 REPEAT 2|16->84|93->162| BL:PDB:NREP 1 BL:PDB:REP 1->168|1oi4B|1e-50|57.1|168/173| RP:PDB:NREP 1 RP:PDB:REP 2->169|2ab0A|2e-30|20.2|168/195| RP:PFM:NREP 1 RP:PFM:REP 51->154|PF01965|9e-19|44.2|104/135|DJ-1_PfpI| HM:PFM:NREP 1 HM:PFM:REP 31->168|PF01965|5.7e-43|46.4|138/148|DJ-1_PfpI| RP:SCP:NREP 1 RP:SCP:REP 4->169|1g2iA|1e-49|42.4|165/166|c.23.16.2| HM:SCP:REP 1->168|1oi4A_|1.6e-53|46.4|168/192|c.23.16.2|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 736 OP:NHOMOORG 576 OP:PATTERN 11-1-1-111111111-111---11--1-11----1111111111-2121232-11111111112--- 11411111----11111----1--11------11111-21-1113-11111-11121----1111122122----111----21111111-1-1-----1-111121121--------------------------2222211111223111-------------121122------------1112---11-311111111111111131442211111123221111113221111111111111111112---------------11----1-----------1--11111111111-------------111111111----221111111111--11-1111212-1-11---1---11-1111-1111-4---1-----1-211--11111-11111111111-1111112312---22121-3211111-1-11111111--11111111-322--11------------------------------1----122212221222111122221111111231111-1221--11112-12-------1-------------11-1--1232113222-121-111-212321-1-21111-------1-------1--1------11---2----------1111-1--1----1111--------1---1-1111111211-11111-2111121111111222-----1111111111111111111111111------------------1--11111--221---------------1111113-112-33331121223223-11---------1-------------11-11111-1--------1----11---1--11--1-1----1-1-1--111-12--1-------------121 ----21--12-1112-----------------------------------------1----------1-----------------------------------111--13-------------------------------------------------11-2-1--1-13------------1-2114-21------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 169 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEcTTccHHHHHHHHHHHHHTTcEEEEcccTTccEEEcTTccEEEccEEHHHHTTccccEEEEcccHHHHHHHHcHHHHHHHHHHHHTTcEEEEETHHHHHTTTTTccccccccccGGGGGGccTTTcccccEEEETTTTEEEEccGGGHHHHHHHHHHHHT PSIPRED cccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEcccccEEEccccEEEEEcccHHHccHHHccEEEEcccccHHHHcccHHHHHHHHHHHHcccEEEEEcHHHHHHHHcccccccEEEEcccHHHHHHHcccEEEcccEEEcccEEEcccccHHHHHHHHHHHHHc //