[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yraD
DDBJ      :yraD         putative spore coat protein
Swiss-Prot:YRAD_BACSU   RecName: Full=Spore coat protein F-like protein yraD;

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   16->77 PF07875 * Coat_F 2e-11 45.2 %
:HMM:PFM   15->78 PF07875 * Coat_F 2.7e-28 45.3 64/64  
:BLT:SWISS 1->99 YRAD_BACSU 1e-54 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14640.1 GT:GENE yraD GT:PRODUCT putative spore coat protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2754820..2755119 GB:FROM 2754820 GB:TO 2755119 GB:DIRECTION + GB:GENE yraD GB:PRODUCT putative spore coat protein GB:FUNCTION 16.13: Shape 16.5: Explore GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 10066829; Product type cp : cell process GB:PROTEIN_ID CAB14640.1 GB:DB_XREF GOA:O06010 InterPro:IPR012851 SubtiList:BG13779 UniProtKB/Swiss-Prot:O06010 GB:GENE:GENE yraD LENGTH 99 SQ:AASEQ MNPIIEYLTGMNVLTDQIIAMDLLISAKNGVRNYAMAATEAGTPEVKEVLIRHLEEALDMHEQLSSYMMEKGWYHPWNPDEQVKLNLKNIDTAIQLPTL GT:EXON 1|1-99:0| SW:ID YRAD_BACSU SW:DE RecName: Full=Spore coat protein F-like protein yraD; SW:GN Name=yraD; OrderedLocusNames=BSU26990; SW:KW Complete proteome; Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->99|YRAD_BACSU|1e-54|100.0|99/99| GO:SWS:NREP 1 GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| RP:PFM:NREP 1 RP:PFM:REP 16->77|PF07875|2e-11|45.2|62/64|Coat_F| HM:PFM:NREP 1 HM:PFM:REP 15->78|PF07875|2.7e-28|45.3|64/64|Coat_F| OP:NHOMO 29 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------311111--1-111--1-122-311--21----------2----------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 98-99| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccc //