[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yraF
DDBJ      :yraF         putative spore coat protein
Swiss-Prot:YRAF_BACSU   RecName: Full=Spore coat protein F-like protein yraF;

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:122 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   19->80 PF07875 * Coat_F 4e-10 40.3 %
:HMM:PFM   19->81 PF07875 * Coat_F 1.8e-22 39.7 63/64  
:BLT:SWISS 1->122 YRAF_BACSU 2e-68 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14637.1 GT:GENE yraF GT:PRODUCT putative spore coat protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2753065..2753433 GB:FROM 2753065 GB:TO 2753433 GB:DIRECTION + GB:GENE yraF GB:PRODUCT putative spore coat protein GB:FUNCTION 16.13: Shape 16.5: Explore GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 10066829; Product type cp : cell process GB:PROTEIN_ID CAB14637.1 GB:DB_XREF GOA:O07949 InterPro:IPR012851 SubtiList:BG12270 UniProtKB/Swiss-Prot:O07949 GB:GENE:GENE yraF LENGTH 122 SQ:AASEQ MNNDHLDPINSLNVPELADTTFAMDFLIRAKEGVRNTAVALTETASPDVRALLRKQLMQGIAMHQEITELMISKKWFHPYELSEQYKLDQLSAKNTIMVGNMNLFPDETNRKGMFDRTPDEH GT:EXON 1|1-122:0| SW:ID YRAF_BACSU SW:DE RecName: Full=Spore coat protein F-like protein yraF; SW:GN Name=yraF; OrderedLocusNames=BSU26960; SW:KW Complete proteome; Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->122|YRAF_BACSU|2e-68|100.0|122/122| GO:SWS:NREP 1 GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| RP:PFM:NREP 1 RP:PFM:REP 19->80|PF07875|4e-10|40.3|62/64|Coat_F| HM:PFM:NREP 1 HM:PFM:REP 19->81|PF07875|1.8e-22|39.7|63/64|Coat_F| OP:NHOMO 12 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------111-2----11----------2----------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 114-122| PSIPRED ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc //