[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yraH
DDBJ      :yraH         putative lyase
Swiss-Prot:YRAH_BACSU   RecName: Full=Uncharacterized protein yraH;

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:128 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   10->128 2qntA PDBj 3e-08 37.4 %
:RPS:PDB   1->128 2a4wB PDBj 2e-17 22.0 %
:RPS:SCOP  2->128 1kllA  d.32.1.2 * 3e-17 22.2 %
:HMM:SCOP  1->125 1q0oA2 d.32.1.3 * 1.5e-23 32.7 %
:RPS:PFM   2->123 PF00903 * Glyoxalase 3e-08 33.0 %
:HMM:PFM   3->124 PF00903 * Glyoxalase 2.8e-21 32.2 121/128  
:BLT:SWISS 1->128 YRAH_BACSU 2e-72 100.0 %
:PROS 5->26|PS00934|GLYOXALASE_I_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14635.1 GT:GENE yraH GT:PRODUCT putative lyase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2752167..2752553) GB:FROM 2752167 GB:TO 2752553 GB:DIRECTION - GB:GENE yraH GB:PRODUCT putative lyase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB14635.1 GB:DB_XREF GOA:O07918 InterPro:IPR018146 SubtiList:BG12272 UniProtKB/Swiss-Prot:O07918 GB:GENE:GENE yraH LENGTH 128 SQ:AASEQ MKLLQIRLLVNDFKKSVEFYKDSLGLPISWLENEMEYALFDNGETKIELLSRETMAEIVGEEKKSLEGEAQSKFLLQFKVEDVDKTYDDLHEKGVKCENKPHDRKEWSARVAHFRDPDHNLIEIYKML GT:EXON 1|1-128:0| SW:ID YRAH_BACSU SW:DE RecName: Full=Uncharacterized protein yraH; SW:GN Name=yraH; OrderedLocusNames=BSU26940; SW:KW Complete proteome; Lyase; Metal-binding; Nickel. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->128|YRAH_BACSU|2e-72|100.0|128/128| GO:SWS:NREP 2 GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 5->26|PS00934|GLYOXALASE_I_1|PDOC00720| BL:PDB:NREP 1 BL:PDB:REP 10->128|2qntA|3e-08|37.4|107/124| RP:PDB:NREP 1 RP:PDB:REP 1->128|2a4wB|2e-17|22.0|127/130| RP:PFM:NREP 1 RP:PFM:REP 2->123|PF00903|3e-08|33.0|115/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 3->124|PF00903|2.8e-21|32.2|121/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 2->128|1kllA|3e-17|22.2|126/128|d.32.1.2| HM:SCP:REP 1->125|1q0oA2|1.5e-23|32.7|110/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ---------------11---------------------------------------------------1---------------------1-------------------------------------------------------1--------------------111-----------------------------1----1-111----11111--------------1--------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 100.0 SQ:SECSTR ccccEEEEEEccHHHHHHHHHTTTccccGGGGGccEEEEEcGGGcEEEEEEHHHHTTTcTTccccccccccEEEEEcccHHHHHHHHHHHHHTTcEEEEEEEEEHTTTEEEEEEEcTTccEEEEEEEc PSIPRED cEEEEEEEEEccHHHHHHHHHHHHccEEEEEcccccEEEEEcccEEEEEcccccccccccccccccccccccEEEEEEEcccHHHHHHHHHHcccEEEEccEEcccccEEEEEEEcccccEEEEEEEc //