[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yraI
DDBJ      :yraI         conserved hypothetical protein
Swiss-Prot:YRAI_BACSU   RecName: Full=Uncharacterized protein yraI;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   65->89 PF08239 * SH3_3 2.7e-07 40.0 25/52  
:BLT:SWISS 26->144 YRAI_BACSU 6e-58 99.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14634.1 GT:GENE yraI GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2751292..2751726) GB:FROM 2751292 GB:TO 2751726 GB:DIRECTION - GB:GENE yraI GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14634.1 GB:DB_XREF InterPro:IPR013247 SubtiList:BG12273 UniProtKB/Swiss-Prot:O07909 GB:GENE:GENE yraI LENGTH 144 SQ:AASEQ MVSESKSLTGCKKVKRTAFIRGGYKVNKLKRLSMLTVMIASVFIFSSHALAAQYYTVSTSSGAPVNMRSGPGTSWGIVTTIPSGTRIPIYCYKTGTTVTGKYGTSNIWNYTERTLASGEIVPGFVSDTYMYTGSDGPVVPKCSW GT:EXON 1|1-144:0| SW:ID YRAI_BACSU SW:DE RecName: Full=Uncharacterized protein yraI;Flags: Precursor; SW:GN Name=yraI; OrderedLocusNames=BSU26930; SW:KW Complete proteome; Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 26->144|YRAI_BACSU|6e-58|99.2|119/119| TM:NTM 1 TM:REGION 32->49| SEG 92->104|yktgttvtgkygt| HM:PFM:NREP 1 HM:PFM:REP 65->89|PF08239|2.7e-07|40.0|25/52|SH3_3| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED ccccccccHHHHHHHHEEEEEccEEEHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEcccccEEEEcccccccccEEEEEccccEEEEEEEEEccEEEEcccccccccEEEcccccEEEcccEEcccEEEccccccccccccc //