[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yraL
DDBJ      :yraL         conserved hypothetical protein
Swiss-Prot:YRAL_BACSU   RecName: Full=Uncharacterized protein yraL;

Homologs  Archaea  0/68 : Bacteria  46/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->88 1rr7A_ a.4.1.14 * 7.9e-15 34.7 %
:RPS:PFM   9->84 PF08765 * Mor 2e-05 37.5 %
:HMM:PFM   11->84 PF08765 * Mor 1.9e-07 31.1 61/108  
:BLT:SWISS 1->87 YRAL_BACSU 5e-47 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14631.1 GT:GENE yraL GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2749260..2749523 GB:FROM 2749260 GB:TO 2749523 GB:DIRECTION + GB:GENE yraL GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14631.1 GB:DB_XREF SubtiList:BG12276 UniProtKB/Swiss-Prot:O07917 GB:GENE:GENE yraL LENGTH 87 SQ:AASEQ MAYVKATAILPEKLISEIQKYVQGKTIYIPKPESSHQKWGACSGTRKLIDDRNASIKKAFKNGKTIHQLSDEYHLSIETIKKIVYSK GT:EXON 1|1-87:0| SW:ID YRAL_BACSU SW:DE RecName: Full=Uncharacterized protein yraL; SW:GN Name=yraL; OrderedLocusNames=BSU26900; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->87|YRAL_BACSU|5e-47|100.0|87/100| RP:PFM:NREP 1 RP:PFM:REP 9->84|PF08765|2e-05|37.5|64/82|Mor| HM:PFM:NREP 1 HM:PFM:REP 11->84|PF08765|1.9e-07|31.1|61/108|Mor| HM:SCP:REP 1->88|1rr7A_|7.9e-15|34.7|75/0|a.4.1.14|1/1|Homeodomain-like| OP:NHOMO 74 OP:NHOMOORG 46 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111-----1111------1------21----------------------------------------------------------------------------1---------------1133334443161-1---1-14----1----11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 35-42| PSIPRED cccHHHHHHcHHHHHHHHHHHHcccEEEccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHccc //