[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yraN
DDBJ      :yraN         putative transcriptional regulator (LysR family)
Swiss-Prot:YRAN_BACSU   RecName: Full=Uncharacterized HTH-type transcriptional regulator yraN;

Homologs  Archaea  8/68 : Bacteria  675/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:289 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->166 1iz1B PDBj 3e-10 28.5 %
:RPS:PDB   1->107 3bj6A PDBj 8e-20 16.8 %
:RPS:PDB   86->282 1al3A PDBj 1e-23 17.9 %
:RPS:SCOP  1->104 1b9mA1  a.4.5.8 * 2e-21 19.2 %
:RPS:SCOP  89->282 1i69A  c.94.1.1 * 1e-22 16.0 %
:HMM:SCOP  1->112 1b9mA1 a.4.5.8 * 9.8e-24 34.3 %
:HMM:SCOP  82->286 1uthA_ c.94.1.1 * 9.5e-28 27.0 %
:RPS:PFM   14->62 PF00126 * HTH_1 7e-06 36.7 %
:RPS:PFM   90->282 PF03466 * LysR_substrate 2e-14 30.2 %
:HMM:PFM   87->283 PF03466 * LysR_substrate 7.1e-36 30.1 193/209  
:HMM:PFM   9->62 PF00126 * HTH_1 2.4e-16 37.0 54/60  
:BLT:SWISS 1->289 YRAN_BACSU e-168 100.0 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14628.1 GT:GENE yraN GT:PRODUCT putative transcriptional regulator (LysR family) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2745594..2746463) GB:FROM 2745594 GB:TO 2746463 GB:DIRECTION - GB:GENE yraN GB:PRODUCT putative transcriptional regulator (LysR family) GB:FUNCTION 16.3: Control GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr: putative regulator GB:PROTEIN_ID CAB14628.1 GB:DB_XREF GOA:O07906 InterPro:IPR011991 SubtiList:BG12278 UniProtKB/Swiss-Prot:O07906 GB:GENE:GENE yraN LENGTH 289 SQ:AASEQ MDEKDWILLKILHEEQSVTKTAERLFTSQPSITYRLKKIEEIFGIELFTKRHKGITFTAEGEHLVAYARRMLQELQDTKDHISNLSKEVQGHLRLGVSSNFAQYKLPKLLREFSTMYPNVQYSVQTGWSTDVMKLLDAGIVQVGILRGSHRWKGVEERLTREKLHIISKKPITIEQLPFLPFIKYKTDASLKTIIEDWMHTNLKQAPIIAMEVDRQETCKEMVKHGLGYSIAPEICLQESDHLYTMELYNAKGKPLMRDTWLMYDQKSLGIKLVKAFIDFLKGEQMVTI GT:EXON 1|1-289:0| SW:ID YRAN_BACSU SW:DE RecName: Full=Uncharacterized HTH-type transcriptional regulator yraN; SW:GN Name=yraN; OrderedLocusNames=BSU26870; SW:KW Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->289|YRAN_BACSU|e-168|100.0|289/289| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| COIL:NAA 34 COIL:NSEG 1 COIL:REGION 62->95| BL:PDB:NREP 1 BL:PDB:REP 23->166|1iz1B|3e-10|28.5|144/294| RP:PDB:NREP 2 RP:PDB:REP 1->107|3bj6A|8e-20|16.8|107/149| RP:PDB:REP 86->282|1al3A|1e-23|17.9|195/237| RP:PFM:NREP 2 RP:PFM:REP 14->62|PF00126|7e-06|36.7|49/60|HTH_1| RP:PFM:REP 90->282|PF03466|2e-14|30.2|189/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 87->283|PF03466|7.1e-36|30.1|193/209|LysR_substrate| HM:PFM:REP 9->62|PF00126|2.4e-16|37.0|54/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->104|1b9mA1|2e-21|19.2|104/122|a.4.5.8| RP:SCP:REP 89->282|1i69A|1e-22|16.0|187/206|c.94.1.1| HM:SCP:REP 1->112|1b9mA1|9.8e-24|34.3|105/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 82->286|1uthA_|9.5e-28|27.0|204/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 4508 OP:NHOMOORG 688 OP:PATTERN -----------------------------------1-111111----------1-------------- 355-5--11111--422----1---4------123247B9-212-1--111-3331-1----2-1281221-2221111-222211112221-1-----117-1-212-5------------------------1-35524---21332544434441111113435443111111111111111-11---53EBBBBBCCC4BBCBCAB5BAEHCBD243A442455544NQ23324332233333364439131343312115522332232-42-11--------------------------------------------349A666667636325443222A41-155421CB552112632221--2-2112211111123E8A3256936344444354358-47454F596C41G9968BAFFDFDAA15166844553692222222223333233-----------------------------1-44-17UQHRVXXZZUEFFFFPPeZIIIJDIjTeNXNQ13GG948797IAK7QB9A62311943344434424388323-2231116112-3-232512122-241121-1------------------1-12BA997541A567588898477A99987A89771--3446------B8A67BBFEEEFFDEDE-EFEDGBDEDDEEEDEEFECHNEAB34AB7D9CCDCDCB8D899F9AA999B2-A43444434444--1411111344334CCK222524355551454FFEFG96132C4FFEFFMJJBLKKK4BDD3221122225BDFG66666799BB564555522211111-1222------------1-------------------------------------321 -------------3------------------------------------------------------------------------------------------------------------------------------------------------8--------------------------1--2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 285 STR:RPRED 98.6 SQ:SECSTR HHHHHHHHHHHTTccccHHHHHHHTTccHHHHHHHHHHHHHTTcEEEcTTccEHEEEcHHHHHHHHHHHHHHHHHHHHHHHTcccccccEEEEEEEEcHHHHHHTcHHHHHHHHHHcTEEEEEEEEccHHHHHHHHHTTcccEEEEcccccTTcEEEEEEEEcEEEEETccccHHHHHTcEEEEEcTTcTTHHHHHHHHHHTHTcccEEEEEEccHHHHHHHHHHTccEEEEEGGGccTTTcTTcEEEcEccTTcccEEEEEEEETTccccHHHHHHHHHHccTT#### DISOP:02AL 84-86, 288-289| PSIPRED ccHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHccEEEEEcccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccEEEEEEcccccccccEEEEEcccccEEccccccHHHHccccEEEEcccccHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHcccHHHHHHHHHHHHHHcccEEEEEccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHccc //