[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yraO
DDBJ      :yraO         putative citrate transporter
Swiss-Prot:YRAO_BACSU   RecName: Full=Uncharacterized transporter yraO;

Homologs  Archaea  0/68 : Bacteria  165/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:438 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   77->325 PF03600 * CitMHS 1e-06 25.0 %
:HMM:PFM   5->384 PF03600 * CitMHS 1.4e-105 41.8 340/349  
:BLT:SWISS 1->424 YRAO_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14627.1 GT:GENE yraO GT:PRODUCT putative citrate transporter GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2744163..2745479) GB:FROM 2744163 GB:TO 2745479 GB:DIRECTION - GB:GENE yraO GB:PRODUCT putative citrate transporter GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 11053381, 15849754, 16850406; Product type pt: putative transporter GB:PROTEIN_ID CAB14627.1 GB:DB_XREF GOA:O05407 InterPro:IPR004680 SubtiList:BG12279 UniProtKB/Swiss-Prot:O05407 GB:GENE:GENE yraO LENGTH 438 SQ:AASEQ MLTILGFSMVTVFTILIMTKKVSPIVALTITPIVFALIGGFGKGIGDMILEGIQTVASSAALLLFAILFFGILIDAGLFDPLIEKILSIVKGDPVKIAIGSAVLAMLIALDGDGTTTYMITVSAMLPLYKRIGMNPMVMATLAMLSLSIVSGMTPWGGPATRAISVLGLDPSDFFVPLLPTMLGGIACVIFLAFLMGRKERNRIGIVQLEPRHITKDSSQSYMAATLESEQLKRPRLIYLNLFLVISIMVFIVLGTKHPSVLFLIGFVLALTINYPNVKMQKERIAEHSGNAITVVLLVFSAGVFAGILSGTKMVDAIAGSLISIIPSSMGGFFPVIVALTSIPFTFVLSNDAYYFGMVPIFAEAASAYGIEPVEIARASIMGQPVHLMSPLVASTVLLVSMLKMDLGSFQRFAVKWAVITSLVITLLAIITGAITIL GT:EXON 1|1-438:0| SW:ID YRAO_BACSU SW:DE RecName: Full=Uncharacterized transporter yraO; SW:GN Name=yraO; OrderedLocusNames=BSU26860; SW:KW Cell membrane; Citrate utilization; Complete proteome; Membrane;Symport; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->424|YRAO_BACSU|0.0|100.0|424/438| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006101|"GO:citrate metabolic process"|Citrate utilization| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0015293|"GO:symporter activity"|Symport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 11 TM:REGION 12->34| TM:REGION 52->74| TM:REGION 102->124| TM:REGION 135->157| TM:REGION 168->190| TM:REGION 236->255| TM:REGION 260->276| TM:REGION 288->310| TM:REGION 323->345| TM:REGION 387->409| TM:REGION 415->437| SEG 60->74|aalllfailffgili| SEG 425->437|itllaiitgaiti| RP:PFM:NREP 1 RP:PFM:REP 77->325|PF03600|1e-06|25.0|236/340|CitMHS| HM:PFM:NREP 1 HM:PFM:REP 5->384|PF03600|1.4e-105|41.8|340/349|CitMHS| GO:PFM:NREP 4 GO:PFM GO:0015137|"GO:citrate transmembrane transporter activity"|PF03600|IPR004680| GO:PFM GO:0015746|"GO:citrate transport"|PF03600|IPR004680| GO:PFM GO:0016021|"GO:integral to membrane"|PF03600|IPR004680| GO:PFM GO:0055085|"GO:transmembrane transport"|PF03600|IPR004680| OP:NHOMO 204 OP:NHOMOORG 166 OP:PATTERN -------------------------------------------------------------------- -------1111--1-----------------------132----1----1111111-2-------12111---------------------------------------------------------------------------------------------------------------------------211111111-111111311133111-------------1--111111111111111--111---11---------111-----------1111-11-----------111111111--11-----------21--------------------------------------------------2-----------------1-----------------1--1-1--1-------------1-----------------------------1----------------------------------------2222221----2211------2----1---11---------------------1111111-------------------------------------------1-11-----------------------------------------------------------------------------------------------------22--1-------------------------------------------------------1---1-----------11111-3---2-11211313122221112------------------------11111111111111----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 215-230| PSIPRED cHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHccccccccccccccHHHccccccccHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHcHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //